Property Summary

NCBI Gene PubMed Count 91
PubMed Score 45.16
PubTator Score 193.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma 1.600 3.3e-03
group 4 medulloblastoma 2.800 3.6e-08
atypical teratoid / rhabdoid tumor 2.800 8.5e-06
medulloblastoma, large-cell 1.600 2.4e-04
primitive neuroectodermal tumor 2.600 2.2e-03
juvenile dermatomyositis 1.212 6.3e-12
lung cancer 3.300 3.5e-04
pediatric high grade glioma 1.300 4.5e-03
pilocytic astrocytoma 1.200 3.0e-05
posterior fossa group A ependymoma 1.100 1.1e-05
subependymal giant cell astrocytoma 1.592 1.4e-02
spina bifida -2.610 3.3e-02
ovarian cancer 2.500 2.6e-05

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
686964 screening 1149 / 0 / 369127 TRFRET-based biochemical primary high throughput screening assay to identify inhibitors of 5-meCpG-binding domain protein 2 (MBD2)-DBD binding to methylated oligonucleotide
686973 summary 0 / 0 / 0 Summary of a probe development effort to identify inhibitors of 5-meCpG-binding domain protein 2 (MBD2)-DBD binding to methylated oligonucleotide
720531 screening 271 / 0 / 765 TRFRET-based biochemical high throughput confirmation assay to identify inhibitors of 5-meCpG-binding domain protein 2 (MBD2)-DBD binding to methylated oligonucleotide
720645 confirmatory 17 / 0 / 29 TRFRET-based biochemical high throughput dose response assay to identify inhibitors of 5-meCpG-binding domain protein 2 (MBD2)-DBD binding to methylated oligonucleotide

Gene RIF (68)

PMID Text
26827827 Specifically, methyl-CpG-binding domain protein 2 (MBD2) is revealed to be recruited to DNA damage sites after laser microirradiation, which was mediated through MBD domain and MBD2 C-terminus.
26788506 downregulation of miR-221 inhibits cell migration and invasion at least partially through targeting MBD2 in the human OSCC cell line UM1.
26007656 The dynamics of MBD2 deposition across methylated DNA regions was associated with the oncogenic transformation of human mammary cells.
25798578 MBD2 targets short interspersed nuclear elements, but does not exclude RNA Polymerase III.
25753662 Biophysical analyses show that the MBD2IDR is an intrinsically disordered region (IDR). However, despite this inherent disorder, MBD2IDR increases the overall binding affinity of MBD2 for methylated DNA.
25178277 These data point to a potential new approach in targeting the DNA methylation machinery by combination of MBD2 and DNMT inhibitors.
25135974 The methylated-DNA binding protein MBD2 enhances NGFI-A (egr-1)-mediated transcriptional activation of the glucocorticoid receptor.
24927503 Data suggest that MBD2 binds primarily at highly methylated regions, with a strong preference for CpG islands and highlights that MBD2 binding sites display increased methylation in primary breast cancer tissues as compared to normal mammary cells.
24849540 This study investigates the genetic association between methyl-CpG-binding domain (MBD) gene polymorphisms and schizophrenia.
24813856 alternatively spliced isoforms support pluripotency of stem cells
24338710 reduced mRNA expression of MBD2 and MBD3 is implicated in gastric carcinogenesis.
24204564 Methylated DNA binding domain protein 2 (MBD2) coordinately silences gene expression through activation of the microRNA hsa-mir-496 promoter in breast cancer cell line.
23955541 MBD2 binds a significant fraction of the hypomethylated genes.
23888954 MBD2 seems to play a selective role in gene repression depending on the CpG content of the promoter region
23820632 global DNA hypomethylation is one of the possible epigenetic variations associated with the complex etiology of TOF and significantly correlates with the aberrant expression of MBD2 mRNA in patients with TOF.
23770133 In metastatic colorectal cancer cells, reduced levels of miR-221* and miR-224 increase levels of MBD2, thereby decreasing expression of the metastasis suppressor maspin.
23361464 MBD3 is enriched at active promoters, whereas MBD2 is bound at methylated promoters and enriched at exon sequences of active genes.
23239876 These factors lead to a binding affinity hierarchy of p66alpha for the different MBD2 homologues (MBD2 approximately MBD3 > MBD3L1 approximately MBD3L2).
23127209 Abnormal expression levels of DNA (cytosine-5-)-methyltransferase 1 and MBD2 mRNA may be important causes of the global hypomethylation observed in CD4+T cells in systemic lupus erythematosus.
23071088 repressive functions of MBD2-containing NuRD complexes are dependent on cooperative interactions between the major domains of CHD4 with histones and DNA and on binding of methylated DNA by MBD2
22876037 MiR-373 behaves as a direct transcriptional target and negative regulator of MBD2 activity through a feedback loop of CpG island methylation in hilar cholangiocarcinoma
22258532 A two-stage association study identifies methyl-CpG-binding domain protein 2 gene polymorphisms as candidates for breast cancer susceptibility.
22048253 The association between MBD2 binding and transcriptional repression weakened as the distance between binding site and TSS increased, suggesting that MBD2 represses transcriptional initiation
21724586 MBD2 overexpression during gliomagenesis may drive tumor growth by suppressing the antiangiogenic activity of a key tumor BAI1.
21693597 These results show a role for MBD2 in cancer progression and provide support for the prospect of targeting MBD2 therapeutically in aggressive breast cancers.
21377502 decreased expression in patients with primary immune thrombocytopenia
21316665 Expression level of MBD2 is significantly lower in endometriotic lesions compared with disease-free controls.
21296012 human epsilon-globin gene is subject to multilayered silencing mediated in part by MBD2
21165562 miR-373 is a methylation-mediated gene and the implication of MBD2 in methylation-mediated suppression of miR-373 plays an important role in tumourigenesis and development in hilar cholangiocarcinoma.
21086164 In hilar cholangiocarcinoma, down-expression of miR-373 leads to increase of MBD2, which in turn suppresses the methylation-mediated gene such as RASSF1A.
21078759 This study demonstrated that patients with SLE had a significantly lower level of DNA methylation than the controls, and that expression of both DNMT1 and MBD2 mRNA was significantly increased in the SLE patients compared with controls.
20937307 The anti-TNFalpha biological agents do not seem to affect DNA methylation and mRNA expressions of DNMT1 and MBD2 in RA
20453000 Observational study of gene-disease association. (HuGE Navigator)
20300195 MBD2 and ERalpha drive opposite effects on pS2 expression, which are associated with specific steady state levels of histone H3 acetylation and methylation marks
19692168 Observational study of gene-disease association. (HuGE Navigator)
19690890 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19454010 Methyl-CpG-binding proteins MBD2 and p66alpha are identified to interact with HIV-1 Tat in Jurkat cell
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19019634 The ratio of MBD-2/DNMT-1 might be valuable in explanation of hypomethylation and evaluation of clinical activity of systemic luopus erythematosus.
18952593 results indicate MBD2 is specifically & directly involved in transcriptional repression of hTERT in HeLa cells & breast, liver & neuroblastoma cancer cell lines; MBD2 seems to be a general repressor of hTERT in hTERT-methylated telomerase-positive cells
18931530 These findings implicate MBD2 in transcriptional repression of the methylated p14(ARF) tumor suppressor gene and suggest that repression by MBD2 selectively affects a subset of methylated promoters.
18830263 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18414412 MBD2 may play an important role in modulating NSCLC patient survival and thus be useful for identifying NSCLC patients who would benefit most from aggressive therapy.
17688412 We found clinically relevant levels of Hcy (0-500 microM) induced elevation of SAH, declination of SAM and SAM/SAH ratio and reduced expression of SAHH and MBD2, but increased activity of DNMT3a and DNMT3b affecting DNA methylation
17634428 These data show, for the first time, the involvement of methyl-CpG binding domain proteins in the regulation of the MAGE-A genes.
17360956 MBD2 and MBD4 transcript overexpression and inverse correlations with DNA methylation indices indicate that both enzymes may really have a direct and active role on the genome-wide DNA hypomethylation observed in CD4+ T cells from SLE patients.
17353267 Results suggest that modulation of MBD2 during gut development establishes a region-specific gene expression pattern that is essential for establishing correct segmental character.
16998846 Sex-specific time windows for concomitant upregulation of MBD2 are associated with prenatal remethylation of the human male and female germ line.
16951344 A previously unrecognized intracellular factor required for the efficient generation of protective memory CD8 T cells.
16428440 MBD2 assembles into mutually exclusive distinct Mi-2/NuRD-like complex, called MBD2/NuRD.
16168120 Observational study of gene-disease association. (HuGE Navigator)
16168120 Genetic variations in rhis methylation related genes may potentially serve as a biomarker in risk estimates for breast cancer.
16052033 MBD2 is associated with the methylated region of a CpG island containing the bidirectional promoter of the Breast cancer predisposition gene 1, BRCA1, and the Near BRCA1 2 (NBR2) gene.
15701600 MBD3L2 interacts with MBD3 and components of the NuRD complex and can oppose MBD2-MeCP1-mediated methylation silencing
15456747 role of MBD3L1 as a methylation-dependent transcriptional repressor that may interchange with MBD3 as an MBD2-interacting component of the NuRD complex
15112265 MBD2 gene expression may be significant factor in tumorigenesis.
14688029 Antisenses oligoDNA suppresses tumor growth in nude mice, a potential anticaner therapy approach.
14610093 MBD2 has a role in the methylation-mediated inhibition of ribosomal RNA gene expression
12665568 MBD2a and RNA helicase A cooperatively enhanced CREB-dependent gene expression.
12646234 Results show that methyl-CpG binding domain protein 1 (MBD1) is expressed in tumor cells, but methyl-CpG binding domain protein 2 (MBD2) and methyl CpG binding protein 2 (MeCP2) are not.
12588985 MBDin relieves MBD2 repression potential and reactivates transcription from methylated promoters
12388720 interacts with latency-associated nuclear antigen of Kaposi's Sarcoma-associated herpesvirus (KSHV)to tether KSHV to cell chromosomes
12183469 interaction with two highly related p66 proteins
12177048 MBD2 protein activates CpG sites within the promoter region of reporter genes
11960994 Methyl-CpG binding domain protein 2 represses transcription from hypermethylated pi-class glutathione S-transferase gene promoters in hepatocellular carcinoma cells

AA Sequence

MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRGRGRWKQAGRG      1 - 70
GGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRG     71 - 140
PRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRT    141 - 210
GKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQ    211 - 280
LFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAV    281 - 350
WLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA             351 - 411
//

Text Mined References (98)

PMID Year Title
26827827 2016 iTRAQ-based chromatin proteomic screen reveals CHD4-dependent recruitment of MBD2 to sites of DNA damage.
26788506 2015 Downregulation of miR-221 Inhibits Cell Migration and Invasion through Targeting Methyl-CpG Binding Domain Protein 2 in Human Oral Squamous Cell Carcinoma Cells.
26007656 2015 Dynamics of MBD2 deposition across methylated DNA regions during malignant transformation of human mammary epithelial cells.
25798578 2015 SINE transcription by RNA polymerase III is suppressed by histone methylation but not by DNA methylation.
25753662 2015 An intrinsically disordered region of methyl-CpG binding domain protein 2 (MBD2) recruits the histone deacetylase core of the NuRD complex.
25178277 2014 Synergistic effects of combined DNA methyltransferase inhibition and MBD2 depletion on breast cancer cells; MBD2 depletion blocks 5-aza-2'-deoxycytidine-triggered invasiveness.
25135974 2014 The methylated-DNA binding protein MBD2 enhances NGFI-A (egr-1)-mediated transcriptional activation of the glucocorticoid receptor.
24927503 2014 Genome-wide binding of MBD2 reveals strong preference for highly methylated loci.
24849540 2014 Genetic association study between methyl-CpG-binding domain genes and schizophrenia among Chinese family trios.
24813856 2014 Alternative splicing of MBD2 supports self-renewal in human pluripotent stem cells.
24338710 2014 Reduced mRNA expression levels of MBD2 and MBD3 in gastric carcinogenesis.
24307175 2014 Probing the dynamic distribution of bound states for methylcytosine-binding domains on DNA.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24204564 2013 Methylated DNA binding domain protein 2 (MBD2) coordinately silences gene expression through activation of the microRNA hsa-mir-496 promoter in breast cancer cell line.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23955541 2013 Transcription onset of genes critical in liver carcinogenesis is epigenetically regulated by methylated DNA-binding protein MBD2.
23888954 2014 The "Methyl-CpG Binding Domain protein 2" plays a repressive role in relation to the promoter CpG content in the normal human cell line MRC5.
23820632 2013 Association between mRNA levels of DNMT1, DNMT3A, DNMT3B, MBD2 and LINE-1 methylation status in infants with tetralogy of Fallot.
23770133 2013 Decreased levels of miR-224 and the passenger strand of miR-221 increase MBD2, suppressing maspin and promoting colorectal tumor growth and metastasis in mice.
23361464 2013 Differential roles for MBD2 and MBD3 at methylated CpG islands, active promoters and binding to exon sequences.
23239876 2013 Unique features of the anti-parallel, heterodimeric coiled-coil interaction between methyl-cytosine binding domain 2 (MBD2) homologues and GATA zinc finger domain containing 2A (GATAD2A/p66?).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23127209 2013 Associations between aberrant DNA methylation and transcript levels of DNMT1 and MBD2 in CD4+T cells from patients with systemic lupus erythematosus.
23071088 2012 MBD2 and multiple domains of CHD4 are required for transcriptional repression by Mi-2/NuRD complexes.
22876037 2012 Mutual regulation between microRNA-373 and methyl-CpG-binding domain protein 2 in hilar cholangiocarcinoma.
22258532 2012 A two-stage association study identifies methyl-CpG-binding domain protein 2 gene polymorphisms as candidates for breast cancer susceptibility.
22048253 2011 Preferential binding of the methyl-CpG binding domain protein 2 at methylated transcriptional start site regions.
21724586 2011 Overexpression of MBD2 in glioblastoma maintains epigenetic silencing and inhibits the antiangiogenic function of the tumor suppressor gene BAI1.
21693597 2011 Methyl-binding domain protein 2-dependent proliferation and survival of breast cancer cells.
21490301 2011 p66Alpha-MBD2 coiled-coil interaction and recruitment of Mi-2 are critical for globin gene silencing by the MBD2-NuRD complex.
21377502 2011 Decreased expression of MBD2 and MBD4 gene and genomic-wide hypomethylation in patients with primary immune thrombocytopenia.
21316665 2011 Deoxyribonucleic acid methyltransferases and methyl-CpG-binding domain proteins in human endometrium and endometriosis.
21296012 2011 MBD2 contributes to developmental silencing of the human ?-globin gene.
21165562 2011 Methyl-CpG binding protein MBD2 is implicated in methylation-mediated suppression of miR-373 in hilar cholangiocarcinoma.
21086164 2011 miR-373 negatively regulates methyl-CpG-binding domain protein 2 (MBD2) in hilar cholangiocarcinoma.
21078759 2011 Global DNA methylation, DNMT1, and MBD2 in patients with systemic lupus erythematosus.
21029866 2010 Nucleosome-interacting proteins regulated by DNA and histone methylation.
20937307 2011 Global DNA methylation, DNMT1, and MBD2 in patients with rheumatoid arthritis.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20300195 2010 A role for methyl-CpG binding domain protein 2 in the modulation of the estrogen response of pS2/TFF1 gene.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690890 2009 Genetic analysis of diabetic nephropathy on chromosome 18 in African Americans: linkage analysis and dense SNP mapping.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19019634 2009 The effect of DNMTs and MBPs on hypomethylation in systemic lupus erythematosus.
18952593 2009 Specific association between the methyl-CpG-binding domain protein 2 and the hypermethylated region of the human telomerase reverse transcriptase promoter in cancer cells.
18931530 2008 MBD2-mediated transcriptional repression of the p14ARF tumor suppressor gene in human colon cancer cells.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18414412 2008 Expression of methylation-related genes is associated with overall survival in patients with non-small cell lung cancer.
17688412 2007 Homocysteine-mediated expression of SAHH, DNMTs, MBD2, and DNA hypomethylation potential pathogenic mechanism in VSMCs.
17634428 2007 Methyl-CpG binding domain proteins and their involvement in the regulation of the MAGE-A1, MAGE-A2, MAGE-A3, and MAGE-A12 gene promoters.
17360956 2007 Transcript overexpression of the MBD2 and MBD4 genes in CD4+ T cells from systemic lupus erythematosus patients.
17353267 2007 MBD2 is required for correct spatial gene expression in the gut.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16998846 2007 Sex-specific windows for high mRNA expression of DNA methyltransferases 1 and 3A and methyl-CpG-binding domain proteins 2 and 4 in human fetal gonads.
16951344 2006 Impaired memory CD8 T cell development in the absence of methyl-CpG-binding domain protein 2.
16428440 2006 MBD2/NuRD and MBD3/NuRD, two distinct complexes with different biochemical and functional properties.
16415179 2006 p66alpha and p66beta of the Mi-2/NuRD complex mediate MBD2 and histone interaction.
16217013 2005 Heterogeneous nuclear ribonucleoprotein C1/C2, MeCP1, and SWI/SNF form a chromatin remodeling complex at the beta-globin locus control region.
16168120 2005 Genotypes and haplotypes of the methyl-CpG-binding domain 2 modify breast cancer risk dependent upon menopausal status.
16052033 2005 Specific binding of the methyl binding domain protein 2 at the BRCA1-NBR2 locus.
15701600 2005 MBD3L2 interacts with MBD3 and components of the NuRD complex and can oppose MBD2-MeCP1-mediated methylation silencing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456747 2004 MBD3L1 is a transcriptional repressor that interacts with methyl-CpG-binding protein 2 (MBD2) and components of the NuRD complex.
15112265 2004 Methyl-CpG-binding domain 2: a protective role in bladder carcinoma.
14688029 2004 Methylated DNA-binding protein 2 antisense inhibitors suppress tumourigenesis of human cancer cell lines in vitro and in vivo.
14610093 2004 Role of human ribosomal RNA (rRNA) promoter methylation and of methyl-CpG-binding protein MBD2 in the suppression of rRNA gene expression.
12665568 2003 Antithetic effects of MBD2a on gene regulation.
12646234 2003 Methyl-CpG-DNA binding proteins in human prostate cancer: expression of CXXC sequence containing MBD1 and repression of MBD2 and MeCP2.
12588985 2003 MBDin, a novel MBD2-interacting protein, relieves MBD2 repression potential and reactivates transcription from methylated promoters.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388720 2002 Protein interactions targeting the latency-associated nuclear antigen of Kaposi's sarcoma-associated herpesvirus to cell chromosomes.
12183469 2002 Two highly related p66 proteins comprise a new family of potent transcriptional repressors interacting with MBD2 and MBD3.
12177048 2002 Promoter-specific activation and demethylation by MBD2/demethylase.
12124384 2002 The mCpG-binding domain of human MBD3 does not bind to mCpG but interacts with NuRD/Mi2 components HDAC1 and MTA2.
11984006 2002 The Chediak-Higashi protein interacts with SNARE complex and signal transduction proteins.
11960994 2002 Methyl-CpG binding domain protein 2 represses transcription from hypermethylated pi-class glutathione S-transferase gene promoters in hepatocellular carcinoma cells.
11756549 2002 Identification and functional characterization of the p66/p68 components of the MeCP1 complex.
11710831 2001 Loss of expression of HDAC-recruiting methyl-CpG-binding domain proteins in human cancer.
11553631 2001 Involvement of a novel zinc finger protein, MIZF, in transcriptional repression by interacting with a methyl-CpG-binding protein, MBD2.
11297506 2001 The MeCP1 complex represses transcription through preferential binding, remodeling, and deacetylating methylated nucleosomes.
11102443 2001 Stable histone deacetylase complexes distinguished by the presence of SANT domain proteins CoREST/kiaa0071 and Mta-L1.
10950960 2000 The minimal repression domain of MBD2b overlaps with the methyl-CpG-binding domain and binds directly to Sin3A.
10947852 2000 MBD2-MBD3 complex binds to hemi-methylated DNA and forms a complex containing DNMT1 at the replication foci in late S phase.
10471499 1999 MBD2 is a transcriptional repressor belonging to the MeCP1 histone deacetylase complex.
10444591 1999 Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation.
10441743 1999 Genomic structure and chromosomal mapping of the murine and human Mbd1, Mbd2, Mbd3, and Mbd4 genes.
10050851 1999 A mammalian protein with specific demethylase activity for mCpG DNA.
9804427 1998 Chromatin deacetylation by an ATP-dependent nucleosome remodelling complex.
9790534 1998 The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling activities.
9774669 1998 Identification and characterization of a family of mammalian methyl-CpG binding proteins.
9610721 1998 Characterization of human colon cancer antigens recognized by autologous antibodies.