Property Summary

NCBI Gene PubMed Count 65
PubMed Score 8413.25
PubTator Score 3314.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.300 4.3e-03
colon cancer -2.300 2.3e-02
non primary Sjogren syndrome sicca 1.100 2.6e-02
lung carcinoma 1.200 2.9e-15
breast carcinoma 1.300 2.8e-17
ductal carcinoma in situ 2.100 1.7e-03
invasive ductal carcinoma 2.200 4.5e-03
ulcerative colitis -1.200 3.8e-03
ovarian cancer 1.200 5.0e-08

 GO Component (1)

Gene RIF (42)

PMID Text
26894983 In the absence of Mb, the Y-shape structure remains intact. So, a weak electrochemical signal is observed. Upon addition of target, the DApt leave the CS and bind to Mb, leading to disassembly of Y-shape structure and following the addition of Exo I, a strong electrochemical signal could be recorded.
26559958 analysis of myoglobin gene regulatory networks in breast and prostate cancer
26271987 Data show that with the myoglobin (MYO) monoclonal antibody of high specificity and affinity, a one-step sandwich ELISA for detecting MYO has been established successfully, which provides a basis for the development of domestic ELISA kit.
25452214 Data show that chimeric neuroglobin and myoglobin were generated by swapping a regulatory segment.
25172328 Analogous to breast cancer, MB expression in prostate cancer is associated with steroid hormone signaling and markers of hypoxia
25002394 A non-ischemic serum myoglobin release is rare, but could be associated in subgroups of patients.
24446190 Findings indicate that myoglobin (Mb) and neuroglobin (Ngb) can be expressed in nonmuscle and non-neural contexts.
24076247 High myoglobin expression is associated with renal cell carcinoma.
24026678 the novel cancer-associated MB splice variants exhibited increased expression in tumor cells subjected to experimental hypoxia; the novel gene regulatory mechanisms unveiled in this study support the idea of a non-canonical role of MB during carcinogenesis
23931877 Blood myoglobin could serve as a valuable early predictor and marker of rhabdomyolysis and acute myoglobinuric kidney injury
23839096 Misfolding and amyloid aggregation of apomyoglobin.
23297402 Hydrophobic effect drives oxygen uptake in myoglobin via histidine E7.
23247055 Our LFIA performance was additionally compared with electrochemiluminescence immunoassay (ECLI) detection for simultaneous determination of hs-cTnI and myoglobin in patients with suggestive of acute myocardial infarction .
21930697 The mitochondrion-impairing role of MB in hypoxic cancer cells is part of a novel tumor-suppressive function.
21782983 MD simulations supported NMR results indicating interesting structural/dynamical differences in the average volume and occurrence of the main cavities lining Mb prosthetic group.
21640426 may have potential significance in the prognostication of lung adenocarcinomas
21639835 Apomyoglobin mutants with point mutations at val10 forms amyloid structures at permissive temperature.
21601304 overexpression in non-small cell lung cancer is associated with histological subtype and hypoxia
21256983 These results show that glutathione reduces hydrogen peroxide-induced protein decomposition due to reduction of the C110-thiyl radical in WTwild type human Mb by electron transfer.
20873231 Kinetics of interaction between apomyoglobin and phospholipid membrane
20668762 Water entry into the heme pockets of isolated hemoglobin subunits was detected by optical methods.
20531416 71% of tumours displayed Mb protein expression in significant correlation with a positive hormone receptor status and better prognosis.
20124401 Using a cardiovascular model suggest that myoglobin oxygen storage/transport becomes significant during systolic reduction of coronary blood flow rather than during diastole.
19650765 Exposure of vascular smooth muscle (either in cell culture or intact vessels) to pathological nitric oxide (*NO) promotes an up-regulation of the Mb gene and protein, suggesting a feedback relationship between *NO and Mb.
19541931 myoglobin is expressed at high levels by human carcinoma cells
19523464 The Dimension Vista cTnI, CK-MB, MYO, NTproBNP, and hsCRP methods demonstrate acceptable performance characteristics for use as an aid in the diagnosis and risk assessment of patients presenting with suspected acute coronary syndromes.
19005161 Hypoxia reprograms calcium signaling and regulates myoglobin expression.
17996904 In this study, we showed for the first time the connection of ROR2 in Dupuytren's disease. ROR2 and myoglobin may play an important role in the pathophysiology of this disease
17883274 analysis of covalent modification, unfolding, and aggregation of human holo-myoglobin induced by tyrosinase-generated quinones
17605115 Data show plasma MG may be considered as a novel marker of muscle mass indicating best the mass of MG-rich type 1 and 2a fibers as well as VO(2)max as an important functional readout.
17311997 iron mobilization and myoglobin down-modulation are elicited by enhanced erythropoiesis from elevated iron
15644316 S-nitroso oxymyoglobin stores vasoactive nitric oxide
15601759 energy analysis of myoglobin recognition of oxygen
15485667 heme rotates about the alpha-gamma axis of human myoglobin without leaving the protein cage
15226631 Binding to blood fatty acid binding protein and may be a marker for cardiac damage in hemodialysis patients.
15226628 Quantitative test is useful for early diagnosis of acute myocardial infarct and as an indicator of its severity.
15048578 determination of myoglobin concentration and succinate dehydrogenase activity in serial sections indicate that myoglobin can lead to a substantial reduction (18-60%) of the extracellular oxygen tension required to prevent an anoxic core in muscle cells
14506721 Oxidative stress associated with myoglobin expression specifically in mitochondrial diseases.
12760310 It was concluded that myoglobin levels on admission and TnT at 2 h had the greatest diagnostic rate for myocardial infarction.
12745799 myoglobin/carbonic anhydrase III ratio in the blood proved to be a more specific indicator for myocardial damage than myoglobin alone after myocardial infarction.
12030657 Observational study of genotype prevalence. (HuGE Navigator)
12006163 Screening of exon 2 of the myoglobin gene in high altitude Tibetans does not show novel polymorphism or selection for specific myoglobin alleles as a function of altitude of residence or hypoxic challenge.

AA Sequence

MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVL      1 - 70
TALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFR     71 - 140
KDMASNYKELGFQG                                                            141 - 154
//

Text Mined References (65)

PMID Year Title
26894983 2016 A novel electrochemical aptasensor based on Y-shape structure of dual-aptamer-complementary strand conjugate for ultrasensitive detection of myoglobin.
26559958 2015 The Distinct Gene Regulatory Network of Myoglobin in Prostate and Breast Cancer.
26271987 2015 [Preparation and application of monoclonal antibody against human myoglobin].
25452214 2015 Engineered chimeras reveal the structural basis of hexacoordination in globins: a case study of neuroglobin and myoglobin.
25172328 2014 Myoglobin expression in prostate cancer is correlated to androgen receptor expression and markers of tumor hypoxia.
25002394 2014 Associated factors for non-ischemic serum myoglobin release after cardiac surgical procedures.
24446190 2014 Hematopoietic stem/progenitor cells express myoglobin and neuroglobin: adaptation to hypoxia or prevention from oxidative stress?
24076247 2013 Myoglobin expression in renal cell carcinoma is regulated by hypoxia.
24026678 2014 Extensive transcriptional complexity during hypoxia-regulated expression of the myoglobin gene in cancer.
23931877 2013 Use of myoglobin as a marker and predictor in myoglobinuric acute kidney injury.
23839096 2013 Misfolding and amyloid aggregation of apomyoglobin.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23297402 2013 Hydrophobic effect drives oxygen uptake in myoglobin via histidine E7.
23247055 2013 Evaluation of a modified lateral flow immunoassay for detection of high-sensitivity cardiac troponin I and myoglobin.
21930697 2011 Endogenous myoglobin in breast cancer is hypoxia-inducible by alternative transcription and functions to impair mitochondrial activity: a role in tumor suppression?
21782983 2011 Structural characterization of recombinant human myoglobin isoforms by (1)H and (129)Xe NMR and molecular dynamics simulations.
21640426 2011 Neuroglobin and myoglobin in non-small cell lung cancer: expression, regulation and prognosis.
21639835 2011 Apomyoglobin mutants with single point mutations at val10 can form amyloid structures at permissive temperature.
21601304 2011 The balance between the expressions of hASH1 and HES1 differs between large cell neuroendocrine carcinoma and small cell carcinoma of the lung.
21256983 2011 Efficient reduction of Cys110 thiyl radical by glutathione in human myoglobin.
20873231 [Kinetics of interaction between apomyoglobin and phospholipid membrane].
20668762 2010 Kinetic spectroscopy of heme hydration and ligand binding in myoglobin and isolated hemoglobin chains: an optical window into heme pocket water dynamics.
20531416 2010 Endogenous myoglobin in human breast cancer is a hallmark of luminal cancer phenotype.
20124401 2010 Significance of myoglobin as an oxygen store and oxygen transporter in the intermittently perfused human heart: a model study.
19650765 2009 Nitric oxide stimulates myoglobin gene and protein expression in vascular smooth muscle.
19541931 2009 Expression and functional regulation of myoglobin in epithelial cancers.
19523464 2009 Cardiovascular disease testing on the Dimension Vista system: biomarkers of acute coronary syndromes.
19005161 2009 Hypoxia reprograms calcium signaling and regulates myoglobin expression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17996904 2008 The expression of myoglobin and ROR2 protein in Dupuytren's disease.
17883274 2007 Tyrosinase-generated quinones induce covalent modification, unfolding, and aggregation of human holo-myoglobin.
17605115 2007 Myoglobin plasma level related to muscle mass and fiber composition: a clinical marker of muscle wasting?
17311997 2007 Strong iron demand during hypoxia-induced erythropoiesis is associated with down-regulation of iron-related proteins and myoglobin in human skeletal muscle.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15644316 2005 Human S-nitroso oxymyoglobin is a store of vasoactive nitric oxide.
15601759 2004 Human myoglobin recognition of oxygen: dynamics of the energy landscape.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485667 2004 Steric effects of isoleucine 107 on heme reorientation reaction in human myoglobin.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15226631 2004 Utility of serum ratio of heart-type fatty acid-binding protein to myoglobin for cardiac damage regardless of renal dysfunction.
15226628 2004 Usefulness of rapid quantitative measurement of myoglobin and troponin T in early diagnosis of acute myocardial infarction.
15048578 2004 Determination of myoglobin concentration and oxidative capacity in cryostat sections of human and rat skeletal muscle fibres and rat cardiomyocytes.
14506721 2003 Overexpressions of myoglobin and antioxidant enzymes in ragged-red fibers of skeletal muscle from patients with mitochondrial encephalomyopathy.
12760310 The diagnostic value of troponin T and myoglobin levels in acute myocardial infarction: a study in Turkish patients.
12745799 2003 Serum myoglobin/carbonic anhydrase III ratio in the diagnosis of perioperative myocardial infarction during coronary bypass surgery.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12030657 2002 Allele frequencies of single nucleotide polymorphisms in the second exon of the myoglobin gene among the Japanese.
11452891 1971 The myoglobin of primates. I. Hylobates agilis (gibbon).
10779502 2000 Reaction of human myoglobin and H2O2. Involvement of a thiyl radical produced at cysteine 110.
10591208 1999 The DNA sequence of human chromosome 22.
9791540 1998 Evolution of myoglobin.
9722578 1998 Identification of myoglobin in human smooth muscle.
8007964 1994 Myocyte nuclear factor, a novel winged-helix transcription factor under both developmental and neural regulation in striated myocytes.
7895732 1994 The human myocardial two-dimensional gel protein database: update 1994.
6571704 1984 Organization of the human myoglobin gene.
6326055 1984 The human myoglobin gene: a third dispersed globin locus in the human genome.
5805522 1969 Abnormal human myoglobin: 53 (D4) glutamic acid--lysine.
5555226 1971 A human myoglobin variant 133 (H-10)lysine--asparagine.
5555219 1971 The third variant of human myoglobin showing an unusual amino acid substitution: 138(H16)arginine--tryptophan.
5540041 1971 The second variant of human myoglobin; 138(H16) arginine leads to glutamine.
5285572 1971 Primary structure of human myoglobin.
4627044 1972 The myoglobin of primates. II. Pan Troglodytes (chimpanzee).
2989088 1985 Cloning of the human myoglobin gene.
2342104 1990 X-ray crystal structure of a recombinant human myoglobin mutant at 2.8 A resolution.
477257 1979 Protein synthesis in isolated human skeletal muscle tissue: evaluation of an experimental model.