Property Summary

NCBI Gene PubMed Count 35
PubMed Score 150.07
PubTator Score 79.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis -1.400 2.3e-02
malignant mesothelioma 1.100 3.4e-05
psoriasis -3.200 4.2e-06
osteosarcoma -1.765 1.2e-06
group 4 medulloblastoma 1.900 2.3e-04
atypical teratoid / rhabdoid tumor 1.400 1.4e-03
glioblastoma 1.200 2.7e-03
medulloblastoma, large-cell 2.100 8.2e-06
lung cancer 1.800 1.5e-04
COPD -1.300 5.8e-03
Polycystic Ovary Syndrome -1.040 4.1e-03
breast carcinoma 1.200 3.3e-18

Gene RIF (21)

PMID Text
26902421 Akt phosphorylates MAZ at Thr385, and the phosphorylated MAZ is released from the p53 promoter, leading to transcriptional activation of p53.
25487955 Myc-associated zinc-finger protein (MAZ) was identified as a direct target of miR-449a, mediating the tumor-suppressive effects.
25449683 Studies show a feed-forward regulatory pathway in breast cancer cells where SAF-1 acts as a transcriptional inducer of Ras which in turn increases DNA-binding and transcriptional activities of SAF-1 which in turn, increases transcription of Ras.
25201524 In conclusion, our present study indicated that miR-34c regulated the permeability of BTB via MAZ-mediated expression changes of ZO-1, occludin, and claudin-5.
23609189 Role of MAZ in prostate cancer and its interaction with androgen receptor were investigated. siRNA knockdown of AR significantly decreased MAZ expression, and knockdown of MAZ significantly increased the expression of AR.
21665940 these findings reveal that SAF-1 is a hitherto unrecognized participant in inducing VEGF expression in triple-negative breast cancer cells, an aggressive form of breast cancer that currently lacks effective treatment options.
19583771 Existence of multiple promoters regulation MAZ, which is expressed during inflammation.
19242545 Observational study of gene-disease association. (HuGE Navigator)
19074642 Gastrin activates paracrine networks leading to induction of PAI-2 via MAZ and ASC-1.
19028685 The SAF-1.c-Fos.c-Jun ternary complex efficiently promotes transcription from both SAF-1 and AP-1 sites of human MMP-1 promoter.
17927842 MAZ and Sp1 play important roles on the transcriptional activation of the human edn promoter through specific binding to a 34-nt segment present in representative primate eosinophil rnase promoters.
17902047 These findings help to define the molecular mechanism driving the high expression of PPARgamma1 in breast cancer and raise new questions regarding the role of MAZ in cancer progression.
17237427 SAF-1 induces VEGF transcription by directly binding to its promoter; markedly higher levels of SAF-1 interaction with the VEGF promoter was detected in the cartilage tissues of arthritic mice as well as human osteoarthritic patients.
16888022 In transgenic mice SAF-1 plays a key role in the development of reactive amyloid A amyloidosis, a consequence of chronic inflammation.
16648491 The MAZ pause element promotes Pol II termination downstream of a poly(A) signal and the strength of the poly(A) signal.
15528467 SAF-1 transcription factor is a regulator of MMP-14 gene induction in monocyte/macrophage cells.
15067082 SAF-1 controls cell cycle progression via p21 induction, and pathophysiological conditions that favor overexpression of SAF-1, such as an acute inflammatory condition, can trigger cellular growth arrest.
14765995 The putative -45 to -39 MYC-associated zinc finger protein-binding site regulates the constitutive activity of human PTHR1 P2 promoter.
12528113 A novel promoter element was detected in the human MMP1 gene, and the inflammation-responsive transcription factor SAF-1 was found to interact with it in osteoarthritis
12509857 epitope spreading between the Tr antigen and the MAZ-DCC complex offers a possible model of immune-mediated cerebellar disease.
12270922 relative abundance of SAF-2 plays a critical role in the fine tuned regulation of inflammation-responsive genes that are controlled by SAF-1

AA Sequence

MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQSPFQAAPAPP      1 - 70
PTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVAAAPPAPAAASTVDTAALKQPPAPPPPPPPV     71 - 140
SAPAAEAAPPASAATIAAAAATAVVAPTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA    141 - 210
IHTGAKAGRVPSGAMKMPTMVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHA    211 - 280
CEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPD    281 - 350
HLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHV    351 - 420
CELCNKGTGEVCPMAAAAAAAAAAAAAAVAAPPTAVGSLSGAEGVPVSSQPLPSQPW                 421 - 477
//

Text Mined References (40)

PMID Year Title
26902421 2016 Akt phosphorylates myc-associated zinc finger protein (MAZ), releases P-MAZ from the p53 promoter, and activates p53 transcription.
25487955 2015 MiR-449a exerts tumor-suppressive functions in human glioblastoma by targeting Myc-associated zinc-finger protein.
25449683 2015 Induction of Ras by SAF-1/MAZ through a feed-forward loop promotes angiogenesis in breast cancer.
25201524 2015 miR-34c regulates the permeability of blood-tumor barrier via MAZ-mediated expression changes of ZO-1, occludin, and claudin-5.
23609189 2013 The prostate cancer-up-regulated Myc-associated zinc-finger protein (MAZ) modulates proliferation and metastasis through reciprocal regulation of androgen receptor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21665940 2011 Control of VEGF expression in triple-negative breast carcinoma cells by suppression of SAF-1 transcription factor activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19583771 2009 SAF-3, a novel splice variant of the SAF-1/MAZ/Pur-1 family, is expressed during inflammation.
19242545 2009 Association and mutation analyses of 16p11.2 autism candidate genes.
19074642 2009 Gastrin activates paracrine networks leading to induction of PAI-2 via MAZ and ASC-1.
19028685 2009 Transcriptional synergy mediated by SAF-1 and AP-1: critical role of N-terminal polyalanine and two zinc finger domains of SAF-1.
17927842 2007 Transcriptional regulation of human eosinophil RNases by an evolutionary- conserved sequence motif in primate genome.
17902047 2008 MAZ drives tumor-specific expression of PPAR gamma 1 in breast cancer cells.
17237427 2007 Vascular endothelial growth factor expression in arthritic joint is regulated by SAF-1 transcription factor.
16888022 2006 Inflammation-responsive transcription factor SAF-1 activity is linked to the development of amyloid A amyloidosis.
16648491 2006 Pause sites promote transcriptional termination of mammalian RNA polymerase II.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15528467 2004 Induction of the MMP-14 gene in macrophages of the atherosclerotic plaque: role of SAF-1 in the induction process.
15067082 2004 Overexpression of serum amyloid A-activating factor 1 inhibits cell proliferation by the induction of cyclin-dependent protein kinase inhibitor p21WAF-1/Cip-1/Sdi-1 expression.
14765995 2004 Functional importance of Myc-associated zinc finger protein for the human parathyroid hormone (PTH)/PTH-related peptide receptor-1 P2 promoter constitutive activity.
12528113 2003 Induction of matrix metalloproteinase 1 gene expression is regulated by inflammation-responsive transcription factor SAF-1 in osteoarthritis.
12509857 2003 The MAZ protein is an autoantigen of Hodgkin's disease and paraneoplastic cerebellar dysfunction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270922 2002 SAF-2, a splice variant of SAF-1, acts as a negative regulator of transcription.
11527412 2001 Interaction of Myc-associated zinc finger protein with DCC, the product of a tumor-suppressor gene, during the neural differentiation of P19 EC cells.
10727212 2000 Fetal Alz-50 clone 1 (FAC1) protein interacts with the Myc-associated zinc finger protein (ZF87/MAZ) and alters its transcriptional activity.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
10448092 1999 The DNA-binding and transcriptional activities of MAZ, a myc-associated zinc finger protein, are regulated by casein kinase II.
9790757 1998 Human genes for KNSL4 and MAZ are located close to one another on chromosome 16p11.2.
9685418 1998 Genomic organization and expression of a human gene for Myc-associated zinc finger protein (MAZ).
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8831693 1996 Members of the MAZ family: a novel cDNA clone for MAZ from human pancreatic islet cells.
8626793 1996 The serotonin 1a receptor gene contains a TATA-less promoter that responds to MAZ and Sp1.
1567856 1992 Isolation of a novel cDNA encoding a zinc-finger protein that binds to two sites within the c-myc promoter.
1502157 1992 MAZ, a zinc finger protein, binds to c-MYC and C2 gene sequences regulating transcriptional initiation and termination.