Property Summary

NCBI Gene PubMed Count 103
PubMed Score 104.82
PubTator Score 789.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
esophageal adenocarcinoma -1.100 1.8e-02
psoriasis -2.000 7.7e-05
osteosarcoma -1.713 2.0e-05
astrocytoma 1.200 1.1e-02
Crohn's disease -1.025 3.7e-04
ulcerative colitis -1.108 8.3e-03
juvenile dermatomyositis 1.401 5.9e-13
acute quadriplegic myopathy 1.041 2.6e-04
non primary Sjogren syndrome sicca 1.200 1.1e-02
subependymal giant cell astrocytoma -1.894 6.6e-03
ovarian cancer -1.900 2.2e-07
dermatomyositis 1.300 2.1e-03

Protein-protein Interaction (1)

Gene RIF (32)

PMID Text
26670126 our results confirm that MAX is a tumor suppressor gene for renal oncocytomas
26555092 In addition, loss of function mutation of the MAX gene was identified for the first time in GIST, and a broader role for MAX in GIST progression was suggested. mechanism for a subset of sporadic gastrointestinal stromal tumors
26474287 Celastrol and some of its quinone methidecontaining analogs directly inhibit c-Myc-Max heterodimers in tumor cells.
26070438 The introduction of wild-type MAX cDNA into PC12 cells significantly decreased MYC's ability to bind to canonical E-boxes, while pathogenic MAX proteins were not able to fully repress MYC activity. Further clinical and molecular evaluation of variant carriers corroborated the results obtained with the functional assessment.
25875098 We confirmed that these dimeric inhibitors directly bind to Myc blocking its interaction with Max and affect transcription of MYC dependent genes.
25451222 Hypoxia reduces MAX expression in endothelial cells by unproductive splicing
24857747 MYC is part of a network of bHLHLZ proteins centered on the MYC heterodimeric partner MAX and its counterpart, the MAX-like protein MLX.
24731854 Here we review the activities of MYC, MNT and other MAX interacting proteins in the setting of T and B cell activation and oncogenesis
24676840 Max mutation is associated with pheochromocytomas and paragangliomas.
24657798 Myc and its obligate heterodimeric partner, Max, are integral to the coordinated recruitment and post-translational modification of components of the core transcriptional machinery.
24362264 Genetic and molecular findings provide powerful evidence that MAX is a tumor-suppressor gene involved in SCLC development.
23743562 MAX mutations remain unusual events in Swedish patients with pheochromocytoma and paraganglioma tumours.
23707073 Delta Max, but not full-length Max, rescues Myc-dependent glycolytic gene expression upon induced EGFRvIII loss, and correlates with hnRNPA1 expression and downstream Myc-dependent gene transcription in patients.
22733550 New structural determinants for c-Myc specific heterodimerization with Max and development of a novel homodimeric c-Myc b-HLH-LZ.
22696478 Data show that Sirt1, p53, and p38(MAPK) are involved in the detrimental phenotype of Max-null ESCs. Analyses revealed these proteins are involved at varying levels to one another in the hierarchy of the pathway leading to cell death in Max-null ESCs.
22452945 germline mutations in MAX are responsible for 1.12% of hereditary and sporadic pheochromocytoma and paraganglioma in patients without evidence of other known mutations
22384171 Max b-HLH-LZ can transduce into cells and inhibit c-Myc transcriptional activities
22086303 Genetic variants in MAX does not contribute to the development of Lynch syndrome.
21873430 The E-box binding factors Max/Mnt, MITF, and USF1 act coordinately with FoxO to regulate expression of proapoptotic and cell cycle control genes by phosphatidylinositol 3-kinase/Akt/glycogen synthase kinase 3 signaling.
21685915 MAX mutations are associated with hereditary pheochromocytoma.
21670079 The transcription factors Max and RXRalpha bind directly to the miR-193a promoter and inhibit miR-193a expression during transformation, thereby activating the PLAU and K-Ras oncogenes.
20214878 Enforced miR-22 expression presumably lowers Max levels available for Myc binding, which differentially influenced the transcription of downstream targets of the Myc-Max complex.
19260139 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19086036 The switch from Mnt-Max to Myc-Max during bile duct ligation (cholestasis) and in hepatocytes treated with lithocholic acid is responsible for the induction in p53 and cyclin D1 expression and contributes to apoptosis.
17217336 results uncover novel post-translational modifications of Max and suggest the potential regulation of specific Max complexes by p300 and reversible acetylation
17082780 Max as a novel co-activator of C/EBPalpha functions, thereby suggesting a possible link between C/EBPalpha and Myc-Max-Mad network.
16475822 Binding affinities & thermodynamics of dimerization of Max-Max homodimer & c-Myc-Max & Mad-Max heterodimers were determined.c-Myc & Max form most stable heterodimer.Polylysine had little effect, polyglutamic acid stabilized both heterodimers & homodimers.
16201965 C6-cer inhibited the DNA-binding function of the c-Myc/Max oncogene
15302589 High levels of Max and stress-induced NFkappaB activation may result in elevated expression of Fas ligand in human lung cancer cells and possibly contribute to Fas ligand-associated immune escape mechanisms.
15258910 downregulation of MYCN was reflected in a decreased MYCN/Max DNA-binding activity while the Mnt/Max binding did not change during differentiation
12553908 X-ray structures of Myc-Max and Mad-Max recognizing DNA. Molecular bases of regulation by proto-oncogenic transcription factors.
11208609 HIV-1 gp120 downregulates expression of c-Myc, Max, and 14-3-3epsilon proteins, and decreases phosphorylation of ATP-dependent tyrosine kinases (Akt) at Ser-473 in human mesangial cells (HMC)

AA Sequence

MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEY      1 - 70
IQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDS     71 - 140
SSESEPEEPQSRKKLRMEAS                                                      141 - 160
//

Text Mined References (110)

PMID Year Title
26670126 2016 Complex MAX Rearrangement in a Family With Malignant Pheochromocytoma, Renal Oncocytoma, and Erythrocytosis.
26555092 2015 Somatic loss of function mutations in neurofibromin 1 and MYC associated factor X genes identified by exome-wide sequencing in a wild-type GIST case.
26474287 2015 Direct inhibition of c-Myc-Max heterodimers by celastrol and celastrol-inspired triterpenoids.
26267534 2015 Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes.
26070438 2015 Functional and in silico assessment of MAX variants of unknown significance.
25875098 2015 Reversible linkage of two distinct small molecule inhibitors of Myc generates a dimeric inhibitor with improved potency that is active in myc over-expressing cancer cell lines.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25451222 2014 Hypoxia reduces MAX expression in endothelial cells by unproductive splicing.
25416956 2014 A proteome-scale map of the human interactome network.
25175806 2014 Drugging MYCN through an allosteric transition in Aurora kinase A.
24951594 2014 Sin3b interacts with Myc and decreases Myc levels.
24857747 2015 Functional interactions among members of the MAX and MLX transcriptional network during oncogenesis.
24731854 2015 The activities of MYC, MNT and the MAX-interactome in lymphocyte proliferation and oncogenesis.
24676840 2014 Opposing effects of HIF1? and HIF2? on chromaffin cell phenotypic features and tumor cell proliferation: Insights from MYC-associated factor X.
24657798 2015 Small-molecule inhibitors of the Myc oncoprotein.
24362264 2014 MAX inactivation in small cell lung cancer disrupts MYC-SWI/SNF programs and is synthetic lethal with BRG1.
23792191 2013 Small molecule inhibitors of aurora-a induce proteasomal degradation of N-myc in childhood neuroblastoma.
23743562 2014 MAX mutations status in Swedish patients with pheochromocytoma and paraganglioma tumours.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23707073 2013 EGFR mutation-induced alternative splicing of Max contributes to growth of glycolytic tumors in brain cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22733550 2012 New structural determinants for c-Myc specific heterodimerization with Max and development of a novel homodimeric c-Myc b-HLH-LZ.
22696478 2012 Sirt1, p53, and p38(MAPK) are crucial regulators of detrimental phenotypes of embryonic stem cells with Max expression ablation.
22452945 2012 MAX mutations cause hereditary and sporadic pheochromocytoma and paraganglioma.
22384171 2012 The Max b-HLH-LZ can transduce into cells and inhibit c-Myc transcriptional activities.
22086303 2012 Mutation and association analyses of the candidate genes ESR1, ESR2, MAX, PCNA, and KAT2A in patients with unexplained MSH2-deficient tumors.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21873430 2011 The E-box binding factors Max/Mnt, MITF, and USF1 act coordinately with FoxO to regulate expression of proapoptotic and cell cycle control genes by phosphatidylinositol 3-kinase/Akt/glycogen synthase kinase 3 signaling.
21859806 2011 Evolution of the Max and Mlx networks in animals.
21815647 2011 Transcription factor beacons for the quantitative detection of DNA binding activity.
21807113 2011 Sirt1 deacetylates c-Myc and promotes c-Myc/Max association.
21685915 2011 Exome sequencing identifies MAX mutations as a cause of hereditary pheochromocytoma.
21670079 2011 Inhibition of miR-193a expression by Max and RXR? activates K-Ras and PLAU to mediate distinct aspects of cellular transformation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21150319 2010 Proteomic profiling of Myc-associated proteins.
20936779 2010 A human MAP kinase interactome.
20691906 2010 Myc-nick: a cytoplasmic cleavage product of Myc that promotes alpha-tubulin acetylation and cell differentiation.
20214878 2010 Differentiation-associated miR-22 represses Max expression and inhibits cell cycle progression.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19260139 2009 Genome-wide association study of anthropometric traits in Korcula Island, Croatia.
19114306 2009 Small-molecule perturbation of competing interactions between c-Myc and Max.
19086036 2009 Switch from Mnt-Max to Myc-Max induces p53 and cyclin D1 expression and apoptosis during cholestasis in mouse and human hepatocytes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18620061 2008 Characterizing proteins and their interactions in cells and tissues using the in situ proximity ligation assay.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17938259 2007 Combined IFN-gamma and retinoic acid treatment targets the N-Myc/Max/Mad1 network resulting in repression of N-Myc target genes in MYCN-amplified neuroblastoma cells.
17876039 2007 Improved low molecular weight Myc-Max inhibitors.
17705400 2007 Direct visualization of the binding of c-Myc/Max heterodimeric b-HLH-LZ to E-box sequences on the hTERT promoter.
17418410 2007 HIF-2alpha promotes hypoxic cell proliferation by enhancing c-myc transcriptional activity.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17315254 2007 Selective inhibition of c-Myc/Max dimerization by a pyrazolo[1,5-a]pyrimidine.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
17274640 2007 A limited screen for protein interactions reveals new roles for protein phosphatase 1 in cell cycle control and apoptosis.
17217336 2007 Max is acetylated by p300 at several nuclear localization residues.
17157259 2006 SNIP1 is a candidate modifier of the transcriptional activity of c-Myc on E box-dependent target genes.
17082780 2006 Proteomic discovery of Max as a novel interacting partner of C/EBPalpha: a Myc/Max/Mad link.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16908182 2006 The MAX-interacting transcription factor network.
16475822 2006 Thermodynamics of protein-protein interactions of cMyc, Max, and Mad: effect of polyions on protein dimerization.
16352593 2006 Targeting of Miz-1 is essential for Myc-mediated apoptosis.
16201965 2006 Regulation of the sphingosine-recycling pathway for ceramide generation by oxidative stress, and its role in controlling c-Myc/Max function.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15960975 2005 Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF.
15809730 2005 Mxi1 isoforms are expressed in hematological cell lines and normal bone marrow.
15674325 2005 PARP-10, a novel Myc-interacting protein with poly(ADP-ribose) polymerase activity, inhibits transformation.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358760 2004 Sterol-responsive element-binding protein (SREBP) 2 down-regulates ATP-binding cassette transporter A1 in vascular endothelial cells: a novel role of SREBP in regulating cholesterol metabolism.
15302589 2004 Synergistic induction of the Fas (CD95) ligand promoter by Max and NFkappaB in human non-small lung cancer cells.
15258910 2004 Expression and DNA-binding activity of MYCN/Max and Mnt/Max during induced differentiation of human neuroblastoma cells.
15121849 2004 Visualization of Myc/Max/Mad family dimers and the competition for dimerization in living cells.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12821782 2003 Human papillomavirus E6 and Myc proteins associate in vivo and bind to and cooperatively activate the telomerase reverse transcriptase promoter.
12584560 2003 Interactions of the DNA mismatch repair proteins MLH1 and MSH2 with c-MYC and MAX.
12553908 2003 X-ray structures of Myc-Max and Mad-Max recognizing DNA. Molecular bases of regulation by proto-oncogenic transcription factors.
12551947 2003 Both Max and TFE3 cooperate with Smad proteins to bind the plasminogen activator inhibitor-1 promoter, but they have opposite effects on transcriptional activity.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391307 2002 JLP: A scaffolding protein that tethers JNK/p38MAPK signaling modules and transcription factors.
12004135 2002 A complex with chromatin modifiers that occupies E2F- and Myc-responsive genes in G0 cells.
11602341 2001 Function and regulation of the transcription factors of the Myc/Max/Mad network.
11535131 2001 Targeting of the transcription factor Max during apoptosis: phosphorylation-regulated cleavage by caspase-5 at an unusual glutamic acid residue in position P1.
11031250 2000 The Myc/Max/Mad network and the transcriptional control of cell behavior.
10611234 2000 The essential cofactor TRRAP recruits the histone acetyltransferase hGCN5 to c-Myc.
10597290 1999 Nmi protein interacts with regions that differ between MycN and Myc and is localized in the cytoplasm of neuroblastoma cells in contrast to nuclear MycN.
10593926 1999 Mlx, a novel Max-like BHLHZip protein that interacts with the Max network of transcription factors.
10229200 1999 Differential effects of the widely expressed dMax splice variant of Max on E-box vs initiator element-mediated regulation by c-Myc.
9680483 1998 Insights into the mechanism of heterodimerization from the 1H-NMR solution structure of the c-Myc-Max heterodimeric leucine zipper.
9199327 1997 Transcription enhancer factor 1 interacts with a basic helix-loop-helix zipper protein, Max, for positive regulation of cardiac alpha-myosin heavy-chain gene expression.
9184233 1997 Rox, a novel bHLHZip protein expressed in quiescent cells that heterodimerizes with Max, binds a non-canonical E box and acts as a transcriptional repressor.
9115440 1997 The crystal structure of an intact human Max-DNA complex: new insights into mechanisms of transcriptional control.
8861962 1996 Myc-Max heterodimers activate a DEAD box gene and interact with multiple E box-related sites in vivo.
8521822 1995 Mad3 and Mad4: novel Max-interacting transcriptional repressors that suppress c-myc dependent transformation and are expressed during neural and epidermal differentiation.
8479534 1993 Recognition by Max of its cognate DNA through a dimeric b/HLH/Z domain.
8426752 1993 Alternative mRNA forms and open reading frames of the max gene.
8425218 1993 Mad: a heterodimeric partner for Max that antagonizes Myc transcriptional activity.
8247525 1993 Identification of casein kinase II phosphorylation sites in Max: effects on DNA-binding kinetics of Max homo- and Myc/Max heterodimers.
7479834 1995 Mxi2, a mitogen-activated protein kinase that recognizes and phosphorylates Max protein.
2006410 1991 Max: a helix-loop-helix zipper protein that forms a sequence-specific DNA-binding complex with Myc.
1594250 1992 Mapping of MAX to human chromosome 14 and mouse chromosome 12 by in situ hybridization.
1566084 1992 Alternative forms of Max as enhancers or suppressors of Myc-ras cotransformation.
1557420 1992 Expression, regulation, and chromosomal localization of the Max gene.
1323849 1992 Opposite orientations of DNA bending by c-Myc and Max.