Property Summary

NCBI Gene PubMed Count 147
PubMed Score 366.50
PubTator Score 360.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.100 6.5e-03
ependymoma 1.200 8.2e-03
oligodendroglioma 1.200 3.3e-03
psoriasis -1.300 7.1e-04
glioblastoma multiforme 1.100 3.2e-21
osteosarcoma 2.284 1.7e-07
Pick disease 1.500 2.7e-05
ulcerative colitis -1.200 2.4e-06
Gaucher disease type 1 -1.200 3.9e-02
cystic fibrosis and chronic rhinosinusit... 1.248 2.0e-02

Protein-protein Interaction (8)

Gene RIF (106)

PMID Text
26998762 Data show that the NS3 protein of dengue virus bound to 14-3-3 epsilon protein (14-3-3varepsilon) and prevented translocation of retinoic acid-inducible gene-I protein (RIG-I) to the adaptor MAVS protein and thereby blocked antiviral signaling.
26954674 This study identified new functional alterations in antiviral signalling based on MAVS polymorphisms
26646717 Using bone marrow derived macrophages from knockout mice we demonstrate that hBD3 suppresses the polyI:C-induced TLR3 response mediated by TICAM1 (TRIF), while exacerbating the cytoplasmic response through MDA5 (IFIH1) and MAVS (IPS1/CARDIF).
26588843 indicate comparable activation of the IFN response by pex- and mito-mitochondrial antiviral-signaling protein in hepatocytes and efficient counteraction of both MAVS species by the HCV nonstructural protein 3 protease
26512076 These results suggest that vIRF-1 is the first example of a viral protein to inhibit mitochondrial antiviral signaling through lipid raft-like microdomains.
26437794 These results demonstrate that poliovirus infection actively suppresses the host type I interferon response by blocking activation of IRF-3 and suggests that this is not mediated by cleavage of MDA-5 or IPS-1.
26385923 Transmembrane motif T6BM2-mediated TRAF6 binding is required for MAVS-related antiviral response.
26375588 HIV-1 Nef (NL4-3) degrades (leads to degradation of) MAVS
26317833 Results show MAVS-transmembrane domain is shown to oligomerize in response to changes in the outer mitochondrial lipid membrane properties caused by treatment with mitochondrial reactive oxygen species inducers or by Sendai virus infection.
26246171 MARCH5 binds MAVS only during viral stimulation when MAVS forms aggregates, and these interactions require the RING domain of MARCH5 and the CARD domain of MAVS.
26223644 During Crimean-Congo hemorrhagic fever virus infection, RIG-I mediated a type I interferon response via MAVS.
26221961 MAVS50, exposing a degenerate TRAF-binding motif within its N-terminus, effectively competed with full-length MAVS for recruiting TRAF2 and TRAF6
26183716 An autoinhibitory mechanism modulates MAVS activity in unstimulated cells and, on viral infection, individual regions of MAVS are released following MAVS filament formation to activate antiviral signalling cascades.
26179906 pVHL Negatively Regulates Antiviral Signaling by Targeting MAVS for Proteasomal Degradation
25950488 IPS-1 induces anticancer activity through upregulation of pro-apoptotic gene TRAIL and downregulation of the anti-apoptotic genes BCL2, BIRC3 and PRKCE via IRF3 and IRF7 in type I interferon-dependent and -independent manners.
25833049 Notably, in Lymphocytic Choriomeningitis Virus-infected cells, RIG-I was dispensable for virus-induced apoptosis via MAVS.
25640825 Polymorphisms in IPS1 are independently associated with treatment response to PEG-IFN among Chinese HBeAg-positive CHB patients.
25636800 findings show MAVS and STING harbor 2 conserved serine and threonine clusters that are phosphorylated by IKK and/or TBK1 in response to stimulation; results reveal phosphorylation of innate adaptor proteins is an essential and conserved mechanism that selectively recruits IRF3 to activate the type I IFN pathway
25609814 Hepatitis C virus NS3-4A similarly diminished both human and mouse MAVS-dependent signaling in human and mouse cells and MAVS induces both type I and type III interferons, which together control the hepatitis C virus replication.
25288302 MAVS did not reveal significant single-SNP associations with multiple sclerosis risk.
25142606 The DLAIS motif in MAVS was found to be critical for MIB2 binding, the ligation of K63-linked ubiquitin to TANK-binding kinase 1, and phosphorylation-mediated IRF3/7 activation.
24889249 NS3 protease of GB virus C cleaved MAVS but not TRIF, and it inhibited interferon responses sufficiently to enhance growth of an interferon-sensitive virus.
24782566 Data indicate that DEAH-box RNA helicase DHX15/PRP43 stimulates the NF-kappaB and MAPK pathways downstream of virus-induced signaling adapter protein MAVS and contributes to MAVS-mediated cytokine production and apoptosis.
24729608 that Smurf2 is an important nonredundant negative regulator of virus-triggered type I IFN signaling by targeting VISA for K48-linked ubiquitination and degradation.
24659800 plays an essential role in stress granule formation
24643253 MAVS protein is attenuated by rotavirus nonstructural protein 1.
24623417 Overall, this study suggests a role for MAVS and RIG-I signaling during different stages of the Kaposi's sarcoma-associated herpesvirus life cycle.
24613846 Collectively, these results demonstrated that eEF1Bgamma functions as a positive regulator of NF-small ka, CyrillicB signal by targeting MAVS for activation, which provides a new regulating mechanism of antiviral responses.
24569476 Elucidate the structural mechanism of MAVS polymerization, and explain how an alpha-helical domain uses distinct chemical interactions to form self-perpetuating filaments.
24529381 Study reports an example of alternative translation as a means of regulating innate immune signaling. MAVS, a regulator of antiviral innate immunity, is expressed from a bicistronic mRNA encoding a second protein, miniMAVS.
24391214 In virus-infected cells, a Bax/Bak-independent pathway involves dsRNA-induced innate immune signaling via mitochondrial antiviral signaling (MAVS) and caspase-8.
24390337 MDA5 and MAVS cleavages are both mediated by coxsackievirus B3 2A protease.
24285545 data thus implicate two parallel pathways by which Gp78 regulates MAVS signaling
24048902 results suggest that MAVS facilitates the recruitment of NLRP3 to the mitochondria and may enhance its oligomerization and activation by bringing it in close proximity to mitochondrial reactive oxygen species.
23582325 Findings reveal a previously undescribed mechanism by which NLRP3 localization to the mitochondria and inflammasome activation are regulated by the mitochondrial adaptor protein MAVS, and identify an N-terminal sequence in NLRP3 that supports its association with MAVS.
23574001 The results establish that the mitochondrial location of IPS-1 is essential to its ability to induce apoptosis.
23460740 rim44 functions as a positive regulator of the virus-triggered immune response by enhancing the stability of VISA.
23308256 IPS-1 oligomerization is essential for the formation of a multiprotein signaling complex.
23246644 The influenza A virus PB2 MAVS-binding domain unexpectedly coincided with its PB1-binding domain, indicating an important dual functionality for this region of PB2.
23087404 Ndfip1 negatively regulates RIG-I-dependent immune signaling by enhancing E3 ligase Smurf1-mediated MAVS degradation.
23028806 These results suggest that the comprehensive regulation of MAVS in response to foreign RNA may be essential to antiviral host defenses.
22901541 Ubiquitination of NEMO negatively regulates the interferon antiviral response through disruption of the MAVS-TRAF3 complex.
22870331 Canine hepacivirus NS3 serine protease can cleave the human adaptor proteins MAVS and TRIF.
22792062 model proposed where dsDNA and dsRNA sensing induces the formation of membrane-bound compartments originating from the Golgi, which mediate the dynamic association of TRAF3 with MAVS leading to an optimal induction of innate immune responses
22674996 Using a flow cytometry-based assay, the authors demonstrate that the PB1-F2 protein inhibits MAVS-mediated IFN synthesis by decreasing the mitochondrial membrane potential (MMP).
22626058 Study reports that RLR activation triggers MAVS ubiquitination on lysine 7 and 10 by the E3 ubiquitin ligase TRIM25 and marks it for proteasomal degradation concomitantly with downstream signaling.
22623778 Human respiratory syncytial virus nucleoprotein and inclusion bodies antagonize the innate immune response mediated by MDA5 and MAVS.
22383950 NS1 binds to MAVS and this binding inhibits the MAVS-RIG-I interaction required for IFN production
22341464 The authors show that FAK interacts with MAVS at the mitochondrial membrane in a virus infection-dependent manner and potentiates MAVS-mediated signaling via a kinase-independent mechanism.
22131337 UXT-V1 represents a novel integral component of the MAVS signalosome on mitochondria, mediating the innate antiviral signal transduction.
22105485 Our findings unravel a critical role of PCBP1 in regulating MAVS for both fine-tuning the antiviral immunity and preventing inflammation
21957149 The ability of DHX9 in sensing both poly I:C and RNA virus is mediated by IPS-1 in myeloid dendritic cells.
21865020 The mitochondrial antiviral signaling (MAVS) adapter protein orchestrates the innate host response to RNA virus infections. (Review)
21813773 Mechanistically, the tetratrico-peptide repeat motif (E164/E165) of IFIT3 interacts with the N terminus (K38) of TBK1, thus bridging TBK1 to MAVS on the mitochondrion
21782231 Viral infection induces the formation of very large MAVS aggregates, which potently activate IRF3 in the cytosol; results suggest that a prion-like conformational switch of MAVS activates and propagates the antiviral signaling cascade.
21421666 NOD2 genotypes also influence the microbial composition in humans.
21285412 Data sugget that DeltaPsi(m) and MAVS are coupled at the same stage in the RLR antiviral signaling pathway.
21268286 In African-American systemic lupus erythematosus, patients, the C79F allele was associated with low type I interferon production and absence of anti-RNA-binding protein autoantibodies.
21200404 A functional C-terminal TRAF3-binding site in mitochondrial antiviral signaling protein participates in positive and negative regulation of the interferon antiviral response
21187438 RIG-I or melanoma differentiation-associated gene (MDA)5 signaling through mitochondrial antiviral signaling protein MAVS is required for activation of interferon (IFN)-beta production by rotavirus-infected intestinal epithelial cells.
21170385 Hepatitis C virus core protein abrogates the DDX3 function that enhances IPS-1-mediated IFN-beta induction
21130742 these results showed that conjunctival epithelial cells express RIG-I and MDA5, and IPS-1, an adaptor molecule common to RIG-I and MDA5, contributes to polyI:C-inducible cytokine production in conjunctival epithelial cells.
21127988 Polymorphisms in the VISA gene may be related to disease susceptibility and manifestations of systemic lupus erythematosus.
21068253 The hepatitis B virus X protein-IPS-1 protein interaction was confirmed in plasmid-transfected HepG2 cells by reciprocal coimmunoprecipitation and Western blotting.
20962078 Chikungunya virus induces via IPS-1 accumulation of IRF-3 dependent antiviral gene mRNA.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20711230 indicate that Hepatitis B virus X protein inhibits signaling by components upstream but not downstream of VISA
20699220 These findings demonstrate that the viral polymerase plays an important role for regulating host anti-viral response through the binding to IPS-1 and inhibition of IFNbeta production.
20661427 viral infection as well as transfection with 5'ppp-RNA resulted in the redistribution of IPS-1 to form speckle-like aggregates in cells.
20554965 Study suggests that HBV can target the RIG-I signaling by HBX-mediated MAVS downregulation, thereby attenuating the antiviral response of the innate immune system.
20538852 Influenza virus A PB2 protein interacts with MAVS and inhibits MAVS-mediated beta interferon expression.
20154210 Chlamydia pneumoniae infection of vascular endothelial cells activates mitochondrial antiviral signaling protein (MAVS) which stimulates IRF3- and IRF7-dependent signals controlling bacterial growth and modulating development of vascular lesions.
20127681 DDX3 can bind viral RNA to join it in the IPS-1 complex. The 622-662 a.a DDX3 C-terminal region directly bound to the IPS-1 CARD-like domain.
20044805 the pre-activation status of the endogenous IFN system in the liver of patients with CHC is in part regulated by cleavage of MAVS.
20032188 study reports MAVS protein level is reduced in Dengue virus-infected cells & that caspases 1 & 3 cleave MAVS at residue D429; MAVS is also a proapoptotic molecule that triggers disruption of the mitochondrial membrane potential & activation of caspases
19914245 c-Abl modulates innate immune response through MAVS.
19902255 Observational study of gene-disease association. (HuGE Navigator)
19881509 PCBP2-AIP4 axis defines a new signaling cascade for MAVS degradation and 'fine tuning' of antiviral innate immunity.
19701189 recognition of a viral ssRNA genome, Nod2 used the adaptor protein MAVS to activate IRF3.
19690333 Data revealed that Mfn2 interacted with the carboxyl-terminal region of MAVS through a heptad repeat region, providing a structural perspective on the regulation of the mitochondrial antiviral response.
19644511 show that interferon-beta promoter stimulator 1 (IPS-1) binds DAP3 and induces anoikis by caspase activation.
19591957 Report shows that Rig-I, but not MAVS, is cleaved during cytomegalovirus infection.
19546225 Polo-like kinase 1 (PLK1) regulates interferon (IFN) induction by MAVS
19380491 recruitment of IKKepsilon to the mitochondria upon MAVS K500 ubiquitination plays a modulatory role in the cascade leading to NF-kappaB activation and expression of inflammatory and antiviral genes
19351494 Data show that DeltaIPS-1 could decrease the secretory volume of IFN-beta in HEK293T cell and could not completely suppress the CPE of the cell infected by HSV-1.
19193783 The activation of RIG-I/MDA-5 leads to the C-terminal transmembrane-dependent dimerization of the MAVS N-terminal caspase recruitment domain, thereby providing an interface for direct binding to and activation of the downstream effector TRAF3.
19028691 PKR, in addition to IPS-1 and IRF3 but not TRIF, was required for maximal type I IFN-beta induction and the induction of apoptosis by both transfected PRNAs and polyinosinic-polycytidylic acid.
18984593 IPS-1 requires TRAF6 and MEKK1 to activate NF-kappaB and mitogen-activated protein kinases that are critical for the optimal induction of type I interferons
18977754 Upon Sendai virus (SeV) infection, TBK1s is induced in both human and mouse cells and binds to RIG-1, disrupting the interaction between RIG-I and VISA
18927075 PKR facilitates the host innate immune response and apoptosis in virus-infected cells by mediating IRF-3 activation through the mitochondrial IPS-1 signal transduction pathway
18756281 Inactivation of Trif and Cardif can also occur through cellular caspases activated by various pro-apoptotic signals.
18692023 The role of MAVS in apoptosis was investigated.
18692023 This paper describes the biochemical regulation and behavior of MAVS during apoptosis.
18550535 RIG-1 - MAVS interacts with cytoplasmic 100-kDa NF-kappa B2 complexes via a novel retinoic acid-inducible gene-I - NF- kappa B-inducing kinase signaling pathway
18307765 Models show a very different charge profile for the equivalent surfaces compared to IPS-1/MAVS/VISA/Cardif CARD.
18207245 This study uncovers MAVS splicing variants of diverse biological function.
17911629 IPS-1 is an essential component of the pathway relevant to polyinosinic-polycytidylic acid signaling of type I interferon in intestinal epithelial cells.
17093192 GBV-B NS3/4A protease specifically cleaves VISA and dislodges it from mitochondria, thereby disrupting its function as a RIG-I adaptor and blocking downstream activation of both interferon regulatory factor 3 and nuclear factor kappa B.
16984921 IPS-1, IRF3, and IFNbeta have critical roles in Legionella infection of lung epithelium
16858409 Cardif induces interferon (IFN)alpha through a direct and specific interaction with the TRAF domain of TRAF3, implicating Cardif as the link between cytoplasmic viral receptors and TRAF3.
16731946 HCV NS3-4A cleavage of human MAVS/IPS-1/VISA/Cardif/K1271 results in its dissociation from the mitochondrial membrane and disrupts signaling to the antiviral immune response
16707574 HCV blocks the dsRNA signaling by an NS3/4A-independent mechanism, in addition to the NS3/4A-dependent cleavage of MAVS/IPS-1.
16585524 HCV infection transiently induces RIG-I- and IPS-1-dependent IRF-3 activation
16177806 KIAA1271 (aka Cardif, MAVS, VISA, IPS-1) has been shown to be targeted by hepatitis c virus (HCV) NS3/4A protease. This cleavage interferes with the Rig-I mediated dsRNA sensing pathway and therefore with the activation of IRF-3.
16153868 Data suggest that VISA is critically involved in both virus-triggered TLR3-independent and TLR3-mediated antiviral interferon signaling.
16125763 Mitochondrial antiviral signaling (MAVS) mediates the activation of NF-kappaB and IRF 3 in response to viral infection, and transmembrane domain targets MAVS to the mitochondria, implicating a new role of mitochondria in innate immunity.

AA Sequence

MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVE      1 - 70
YFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSY     71 - 140
PMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGA    141 - 210
TSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEP    211 - 280
IICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLP    281 - 350
INSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSK    351 - 420
PGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPD    421 - 490
GGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH                        491 - 540
//

Text Mined References (163)

PMID Year Title
26998762 2016 A phosphomimetic-based mechanism of dengue virus to antagonize innate immunity.
26954674 2016 Alteration of Antiviral Signalling by Single Nucleotide Polymorphisms (SNPs) of Mitochondrial Antiviral Signalling Protein (MAVS).
26646717 2015 Human ?-Defensin 3 [corrected] Exacerbates MDA5 but Suppresses TLR3 Responses to the Viral Molecular Pattern Mimic Polyinosinic:Polycytidylic Acid.
26588843 2015 Activation of Type I and III Interferon Response by Mitochondrial and Peroxisomal MAVS and Inhibition by Hepatitis C Virus.
26512076 2015 Modulation of Mitochondrial Antiviral Signaling by Human Herpesvirus 8 Interferon Regulatory Factor 1.
26437794 2015 Proteolysis of MDA5 and IPS-1 is not required for inhibition of the type I IFN response by poliovirus.
26385923 2015 Structural Insights into mitochondrial antiviral signaling protein (MAVS)-tumor necrosis factor receptor-associated factor 6 (TRAF6) signaling.
26317833 2015 Modulation of Innate Immune Signalling by Lipid-Mediated MAVS Transmembrane Domain Oligomerization.
26246171 2015 The mitochondrial ubiquitin ligase MARCH5 resolves MAVS aggregates during antiviral signalling.
26223644 2015 RIG-I Mediates an Antiviral Response to Crimean-Congo Hemorrhagic Fever Virus.
26221961 2015 An Internally Translated MAVS Variant Exposes Its Amino-terminal TRAF-Binding Motifs to Deregulate Interferon Induction.
26183716 2015 An autoinhibitory mechanism modulates MAVS activity in antiviral innate immune response.
26179906 2015 pVHL Negatively Regulates Antiviral Signaling by Targeting MAVS for Proteasomal Degradation.
25950488 2015 IPS-1 differentially induces TRAIL, BCL2, BIRC3 and PRKCE in type I interferons-dependent and -independent anticancer activity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25833049 2015 Lymphocytic Choriomeningitis Virus Differentially Affects the Virus-Induced Type I Interferon Response and Mitochondrial Apoptosis Mediated by RIG-I/MAVS.
25640825 2015 Association of IPS1 polymorphisms with peginterferon efficacy in chronic hepatitis B with HBeAg-positive in the Chinese population.
25636800 2015 Phosphorylation of innate immune adaptor proteins MAVS, STING, and TRIF induces IRF3 activation.
25609814 2015 Control of hepatitis C virus replication in mouse liver-derived cells by MAVS-dependent production of type I and type III interferons.
25416956 2014 A proteome-scale map of the human interactome network.
25288302 2014 Analysis of polymorphisms in RIG-I-like receptor genes in German multiple sclerosis patients.
25142606 2014 Lysine 63-linked TANK-binding kinase 1 ubiquitination by mindbomb E3 ubiquitin protein ligase 2 is mediated by the mitochondrial antiviral signaling protein.
25018021 2014 Molecular imprinting as a signal-activation mechanism of the viral RNA sensor RIG-I.
24889249 2014 Human pegivirus (GB virus C) NS3 protease activity inhibits induction of the type I interferon response and is not inhibited by HCV NS3 protease inhibitors.
24782566 2014 The DEAH-box RNA helicase DHX15 activates NF-?B and MAPK signaling downstream of MAVS during antiviral responses.
24729608 2014 Smurf2 negatively modulates RIG-I-dependent antiviral response by targeting VISA/MAVS for ubiquitination and degradation.
24706939 2014 Viral suppression of innate immunity via spatial isolation of TBK1/IKK? from mitochondrial antiviral platform.
24659800 2014 IPS-1 plays an essential role in dsRNA-induced stress granule formation by interacting with PKR and promoting its activation.
24643253 2014 MAVS protein is attenuated by rotavirus nonstructural protein 1.
24623417 2014 An important role for mitochondrial antiviral signaling protein in the Kaposi's sarcoma-associated herpesvirus life cycle.
24613846 2014 eEF1B? is a positive regulator of NF-?B signaling pathway.
24569476 2014 Structural basis for the prion-like MAVS filaments in antiviral innate immunity.
24529381 2014 A bicistronic MAVS transcript highlights a class of truncated variants in antiviral immunity.
24478431 2014 Hijacking of RIG-I signaling proteins into virus-induced cytoplasmic structures correlates with the inhibition of type I interferon responses.
24391214 2014 A novel mitochondrial MAVS/Caspase-8 platform links RNA virus-induced innate antiviral signaling to Bax/Bak-independent apoptosis.
24390337 2014 Enterovirus 2Apro targets MDA5 and MAVS in infected cells.
24285545 2014 Regulation of mitochondrial antiviral signaling (MAVS) expression and signaling by the mitochondria-associated endoplasmic reticulum membrane (MAM) protein Gp78.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24048902 2013 The mitochondrial antiviral protein MAVS associates with NLRP3 and regulates its inflammasome activity.
23711367 2013 A role for the Ankyrin repeat containing protein Ankrd17 in Nod1- and Nod2-mediated inflammatory responses.
23582325 2013 The adaptor MAVS promotes NLRP3 mitochondrial localization and inflammasome activation.
23574001 2013 Mitochondrial localization of the antiviral signaling adaptor IPS-1 is important for its induction of caspase activation.
23542348 2013 Hepatitis C virus NS4B blocks the interaction of STING and TBK1 to evade host innate immunity.
23460740 2013 Novel function of Trim44 promotes an antiviral response by stabilizing VISA.
23399697 2013 Mitochondrially localised MUL1 is a novel modulator of antiviral signaling.
23308256 2013 Functional characterization of domains of IPS-1 using an inducible oligomerization system.
23246644 2013 Influenza A polymerase subunit PB2 possesses overlapping binding sites for polymerase subunit PB1 and human MAVS proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23087404 2012 Ndfip1 negatively regulates RIG-I-dependent immune signaling by enhancing E3 ligase Smurf1-mediated MAVS degradation.
23028806 2012 Foreign RNA induces the degradation of mitochondrial antiviral signaling protein (MAVS): the role of intracellular antiviral factors.
23015697 2012 Human metapneumovirus M2-2 protein inhibits innate cellular signaling by targeting MAVS.
22911572 2013 Hepatitis C virus NS4B protein targets STING and abrogates RIG-I-mediated type I interferon-dependent innate immunity.
22908223 2012 Tetraspanin 6 (TSPAN6) negatively regulates retinoic acid-inducible gene I-like receptor-mediated immune signaling in a ubiquitination-dependent manner.
22901541 2012 Linear ubiquitination of NEMO negatively regulates the interferon antiviral response through disruption of the MAVS-TRAF3 complex.
22870331 2012 Canine hepacivirus NS3 serine protease can cleave the human adaptor proteins MAVS and TRIF.
22792062 2012 Proteomic profiling of the TRAF3 interactome network reveals a new role for the ER-to-Golgi transport compartments in innate immunity.
22674996 2012 Influenza virus protein PB1-F2 inhibits the induction of type I interferon by binding to MAVS and decreasing mitochondrial membrane potential.
22626058 2012 MAVS ubiquitination by the E3 ligase TRIM25 and degradation by the proteasome is involved in type I interferon production after activation of the antiviral RIG-I-like receptors.
22623778 2012 Human respiratory syncytial virus nucleoprotein and inclusion bodies antagonize the innate immune response mediated by MDA5 and MAVS.
22427742 2012 Convergent evolution of escape from hepaciviral antagonism in primates.
22383950 2012 Respiratory syncytial virus NS1 protein colocalizes with mitochondrial antiviral signaling protein MAVS following infection.
22341464 2012 Focal adhesion kinase is a component of antiviral RIG-I-like receptor signaling.
22328336 2012 Ankrd17 positively regulates RIG-I-like receptor (RLR)-mediated immune signaling.
22301138 2012 Herpes simplex virus 1 tegument protein US11 downmodulates the RLR signaling pathway via direct interaction with RIG-I and MDA-5.
22131337 2012 UXT-V1 facilitates the formation of MAVS antiviral signalosome on mitochondria.
22105485 2012 Poly(C)-binding protein 1 (PCBP1) mediates housekeeping degradation of mitochondrial antiviral signaling (MAVS).
22000020 2011 Activation of STAT6 by STING is critical for antiviral innate immunity.
21957149 2011 DHX9 pairs with IPS-1 to sense double-stranded RNA in myeloid dendritic cells.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21865020 2011 Orchestrating the interferon antiviral response through the mitochondrial antiviral signaling (MAVS) adapter.
21813773 2011 IFN-induced TPR protein IFIT3 potentiates antiviral signaling by bridging MAVS and TBK1.
21782231 2011 MAVS forms functional prion-like aggregates to activate and propagate antiviral innate immune response.
21421666 2011 Nod2 is essential for temporal development of intestinal microbial communities.
21285412 2011 Mitochondrial membrane potential is required for MAVS-mediated antiviral signaling.
21269460 2011 Initial characterization of the human central proteome.
21268286 2011 A loss-of-function variant of the antiviral molecule MAVS is associated with a subset of systemic lupus patients.
21200404 2011 A functional C-terminal TRAF3-binding site in MAVS participates in positive and negative regulation of the IFN antiviral response.
21187438 2011 RIG-I/MDA5/MAVS are required to signal a protective IFN response in rotavirus-infected intestinal epithelium.
21170385 2010 Hepatitis C virus core protein abrogates the DDX3 function that enhances IPS-1-mediated IFN-beta induction.
21130742 2011 Contribution of IPS-1 to polyI:C-induced cytokine production in conjunctival epithelial cells.
21127988 2011 Possible association of VISA gene polymorphisms with susceptibility to systemic lupus erythematosus in Chinese population.
21102435 2011 ZAPS is a potent stimulator of signaling mediated by the RNA helicase RIG-I during antiviral responses.
21068253 2011 Hepatitis B virus regulatory HBx protein binds to adaptor protein IPS-1 and inhibits the activation of beta interferon.
20962078 2011 Chikungunya virus induces IPS-1-dependent innate immune activation and protein kinase R-independent translational shutoff.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20711230 2010 Hepatitis B virus X protein suppresses virus-triggered IRF3 activation and IFN-beta induction by disrupting the VISA-associated complex.
20699220 2010 Influenza A virus polymerase inhibits type I interferon induction by binding to interferon beta promoter stimulator 1.
20661427 2010 Virus-infection or 5'ppp-RNA activates antiviral signal through redistribution of IPS-1 mediated by MFN1.
20554965 2010 The hepatitis B virus X protein disrupts innate immunity by downregulating mitochondrial antiviral signaling protein.
20538852 2010 The PB2 subunit of the influenza virus RNA polymerase affects virulence by interacting with the mitochondrial antiviral signaling protein and inhibiting expression of beta interferon.
20451243 2010 Peroxisomes are signaling platforms for antiviral innate immunity.
20159242 2010 Genome-wide association study of asthma identifies RAD50-IL13 and HLA-DR/DQ regions.
20154210 2010 Essential role of mitochondrial antiviral signaling, IFN regulatory factor (IRF)3, and IRF7 in Chlamydophila pneumoniae-mediated IFN-beta response and control of bacterial replication in human endothelial cells.
20127681 2010 DEAD/H BOX 3 (DDX3) helicase binds the RIG-I adaptor IPS-1 to up-regulate IFN-beta-inducing potential.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20044805 2010 Cleavage of mitochondrial antiviral signaling protein in the liver of patients with chronic hepatitis C correlates with a reduced activation of the endogenous interferon system.
20032188 2010 The interferon stimulator mitochondrial antiviral signaling protein facilitates cell death by disrupting the mitochondrial membrane potential and by activating caspases.
20019757 2010 Mitochondrial dynamics regulate the RIG-I-like receptor antiviral pathway.
20007272 2010 Z proteins of New World arenaviruses bind RIG-I and interfere with type I interferon induction.
19914245 2010 c-Abl tyrosine kinase interacts with MAVS and regulates innate immune response.
19902255 2010 Rubella vaccine-induced cellular immunity: evidence of associations with polymorphisms in the Toll-like, vitamin A and D receptors, and innate immune response genes.
19893624 2009 The E3 ubiquitin ligase Triad3A negatively regulates the RIG-I/MAVS signaling pathway by targeting TRAF3 for degradation.
19881509 2009 PCBP2 mediates degradation of the adaptor MAVS via the HECT ubiquitin ligase AIP4.
19734229 2009 Negative regulation of MAVS-mediated innate immune response by PSMA7.
19701189 2009 Activation of innate immune antiviral responses by Nod2.
19690333 2009 Mitofusin 2 inhibits mitochondrial antiviral signaling.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19644511 2009 IPS-1 is crucial for DAP3-mediated anoikis induction by caspase-8 activation.
19631370 2009 RNA polymerase III detects cytosolic DNA and induces type I interferons through the RIG-I pathway.
19609254 2009 RIG-I-dependent sensing of poly(dA:dT) through the induction of an RNA polymerase III-transcribed RNA intermediate.
19591957 2009 Degradation of RIG-I following cytomegalovirus infection is independent of apoptosis.
19546225 2009 Polo-like kinase 1 (PLK1) regulates interferon (IFN) induction by MAVS.
19419966 2009 The tyrosine kinase c-Src enhances RIG-I (retinoic acid-inducible gene I)-elicited antiviral signaling.
19416887 2009 ISG56 is a negative-feedback regulator of virus-triggered signaling and cellular antiviral response.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19380491 2009 Ubiquitin-regulated recruitment of IkappaB kinase epsilon to the MAVS interferon signaling adapter.
19351494 2009 [Effect of deletion mutant IPS-1 on IFN-beta induction and its antiviral to HSV-1].
19193793 2009 Human respiratory syncytial virus nonstructural protein NS2 antagonizes the activation of beta interferon transcription by interacting with RIG-I.
19193783 2009 MAVS self-association mediates antiviral innate immune signaling.
19164550 2009 Inhibition of RIG-I and MDA5-dependent antiviral response by gC1qR at mitochondria.
19153231 2009 Ebola virus protein VP35 impairs the function of interferon regulatory factor-activating kinases IKKepsilon and TBK-1.
19028691 2009 The RNA-activated protein kinase enhances the induction of interferon-beta and apoptosis mediated by cytoplasmic RNA sensors.
18984593 2008 TRAF6 and MEKK1 play a pivotal role in the RIG-I-like helicase antiviral pathway.
18977754 2008 Negative regulation of virus-triggered IFN-beta signaling pathway by alternative splicing of TBK1.
18927075 2008 Induction of protein kinase PKR-dependent activation of interferon regulatory factor 3 by vaccinia virus occurs through adapter IPS-1 signaling.
18818105 2008 The adaptor protein MITA links virus-sensing receptors to IRF3 transcription factor activation.
18756281 2008 The antiviral adaptor proteins Cardif and Trif are processed and inactivated by caspases.
18692023 2008 The mitochondrial antiviral signaling protein, MAVS, is cleaved during apoptosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18636086 2008 The tumour suppressor CYLD is a negative regulator of RIG-I-mediated antiviral response.
18550535 2008 Respiratory syncytial virus induces RelA release from cytoplasmic 100-kDa NF-kappa B2 complexes via a novel retinoic acid-inducible gene-I{middle dot}NF- kappa B-inducing kinase signaling pathway.
18307765 2008 Crystal structure of human IPS-1/MAVS/VISA/Cardif caspase activation recruitment domain.
18207245 2008 Identification of MAVS splicing variants that interfere with RIGI/MAVS pathway signaling.
18200010 2008 NLRX1 is a regulator of mitochondrial antiviral immunity.
18088087 2008 Phosphoproteome of resting human platelets.
17911629 2007 Activation of innate immune defense mechanisms by signaling through RIG-I/IPS-1 in intestinal epithelial cells.
17600090 2007 Negative regulation of MDA5- but not RIG-I-mediated innate antiviral signaling by the dihydroxyacetone kinase.
17438296 2007 Disruption of innate immunity due to mitochondrial targeting of a picornaviral protease precursor.
17093192 2007 GB virus B disrupts RIG-I signaling by NS3/4A-mediated cleavage of the adaptor protein MAVS.
17020950 2006 RNA- and virus-independent inhibition of antiviral signaling by RNA helicase LGP2.
16984921 2006 Legionella pneumophila induces IFNbeta in lung epithelial cells via IPS-1 and IRF3, which also control bacterial replication.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16914100 2006 Induction of IRF-3 and IRF-7 phosphorylation following activation of the RIG-I pathway.
16858409 2006 Regulation of antiviral responses by a direct and specific interaction between TRAF3 and Cardif.
16731946 2006 Dissociation of a MAVS/IPS-1/VISA/Cardif-IKKepsilon molecular complex from the mitochondrial outer membrane by hepatitis C virus NS3-4A proteolytic cleavage.
16707574 2006 Inhibition of dsRNA-induced signaling in hepatitis C virus-infected cells by NS3 protease-dependent and -independent mechanisms.
16585524 2006 Viral and therapeutic control of IFN-beta promoter stimulator 1 during hepatitis C virus infection.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16301520 2005 Hepatitis C virus protease NS3/4A cleaves mitochondrial antiviral signaling protein off the mitochondria to evade innate immunity.
16239922 2005 Hitching RIG to action.
16177806 2005 Cardif is an adaptor protein in the RIG-I antiviral pathway and is targeted by hepatitis C virus.
16153868 2005 VISA is an adapter protein required for virus-triggered IFN-beta signaling.
16127453 2005 IPS-1, an adaptor triggering RIG-I- and Mda5-mediated type I interferon induction.
16125763 2005 Identification and characterization of MAVS, a mitochondrial antiviral signaling protein that activates NF-kappaB and IRF 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11002417 2000 Activation of the NF-kappaB pathway by caspase 8 and its homologs.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.