Property Summary

NCBI Gene PubMed Count 60
PubMed Score 49.31
PubTator Score 53.29

Knowledge Summary

Patent

No data available

Expression

Gene RIF (42)

PMID Text
26899464 A missense mutation in MATR3 was identified in myopathy patients undergoing a needle electromyography.
26528920 Our findings indicate that mutations in Matrin 3 that are associated with ALS and myopathy do not dramatically alter the normal localization of the protein or readily induce inclusion formation.
26493020 Its mutations strengthens the role of RNA metabolism in amyotrophic lateral sclerosis etiology.
26129669 Suppressing Matrin 3 powers a heightened and broader ZAP restriction of HIV-1 gene expression.
26129669 siRNA knockdown of MATR3 improves the ZAP-induced degradation of HIV-1 transcripts; MATR3 enhances HIV-1 replication
25948554 Three-dimensional mapping of the lamin A-matrin-3 interface showed that the LMNA truncating mutation Delta303, which lacks the matrin-3 binding domain, was associated with an increased distance between lamin A and matrin-3.
25771394 MATR3 mutation is identified to be a possible cause of amyotrophic lateral sclerosis.
25677933 This study shows a high risk of abnormal respiratory function with progressive worsening in MATR3 myopathy.
25599992 Nuclear matrix protein Matrin3 regulates alternative splicing and forms overlapping regulatory networks with PTB.
25574029 MATR3 gene disruption is associated with bicuspid aortic valve, aortic coarctation and patent ductus arteriosus.
25523636 No mutations were identified, indicating that MATR3 mutations are not a common cause of Amyotrophic lateral sclerosis in Australian familial cases with predominately European ancestry
25496916 Matrin 3 protein (MATR3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25158920 Mutations in MATR3 are rare in French familial ALS and ALS with FTLD patients.
25154462 Sixteen patients from 6 families with late onset distal myopathy associated with the p.S85C MATR3 mutation were characterized.
24686783 This study identified mutations in MATR3 in ALS kindreds. also observed MATR3 pathology in ALS-affected spinal cords with and without MATR3 mutations.
24558381 the pY RNA1-s2/Matr3 interaction could play a role in vision
23874603 Matrin 3 protein (MATR3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23158102 Matrin 3 protein (MATR3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23125841 Matrin 3 protein (MATR3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
22190034 Matrin 3 protein (MATR3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
22174317 Matrin 3 protein (MATR3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
21858232 Data suggest that the cellular level of MATR3, known to be highly regulated, modulates the stability of a group of gene transcripts.
21771348 Rev needs MATR3 to promote the cytoplasmic accumulation and translation of unspliced RRE-containing mRNA.
21771348 Matrin 3 protein (MATR3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
21771347 Matrin 3 binds Rev RNA to stabilize HIV-1 transcripts leading to increased cytoplasmic expression.
21771347 Matrin 3 protein (MATR3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
21771346 MATR3 binds viral RNA and is required for the Rev/RRE mediated nuclear export of unspliced HIV-1 RNAs.
21771346 Matrin 3 protein (MATR3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
21683594 This study identified no pathogenic mutations in BAG3, MATR3, PTRF or TCAP in Australian muscular dystrophy.
21182838 matrin 3 plays a significant role in controlling cell growth and proliferation
20421735 MATR3 to be a novel ATM target in response to DNA damage.
19836620 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19562669 study of the association of matr3 with chromosome territories and identification of potential interacting proteins
19344878 nonconservative S85C missense mutation in vocal cord and pharyngeal weakness with distal myopathy
19240791 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18618731 the spatial proximities among a constellation of functionally related sites that are found within euchromatic regions of the cell nucleus including: HP1gamma, RNA polymerase II, matrin 3, and SAF-A sites
17658460 These results suggest that the functions of matrin 3 could be regulated by both Ca(2+)-dependent interaction with calmodulin and caspase-mediated cleavage.
12469345 Data show that the nuclear matrix protein matrin 3, cytoskeletal motor protein HMP, and the circadian clock protein lark were significantly decreased in fetal Down syndrome brain.

AA Sequence

MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTARLASLMNLGMSSSLNQQGAH      1 - 70
SALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGDADQASNILASFGLSARDLDELSRYPEDKITPENLPQ     71 - 140
ILLQLKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWEEKRHFRRDSFDDRGPSLNPVLDYDHGSRSQE    141 - 210
SGYYDRMDYEDDRLRDGERCRDDSFFGETSHNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIED    211 - 280
FHGLLPKGYPHLCSICDLPVHSNKEWSQHINGASHSRRCQLLLEIYPEWNPDNDTGHTMGDPFMLQQSTN    281 - 350
PAPGILGPPPPSFHLGGPAVGPRGNLGAGNGNLQGPRHMQKGRVETSRVVHIMDFQRGKNLRYQLLQLVE    351 - 420
PFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKKPEGKPDQKFDQ    421 - 490
KQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQ    491 - 560
GRCVKVDLSEKYKKLVLRIPNRGIDLLKKDKSRKRSYSPDGKESPSDKKSKTDGSQKTESSTEGKEQEEK    561 - 630
SGEDGEKDTKDDQTEQEPNMLLESEDELLVDEEEAAALLESGSSVGDETDLANLGDVASDGKKEPSDKAV    631 - 700
KKDGSASAAAKKKLKKVDKIEELDQENEAALENGIKNEENTEPGAESSENADDPNKDTSENADGQSDENK    701 - 770
DDYTIPDEYRIGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEE    771 - 840
RRQKKET                                                                   841 - 847
//

Text Mined References (80)

PMID Year Title
26899464 2016 Needle electromyography findings in patients with MATR3 mutation - A prospective study.
26528920 2015 Subcellular Localization of Matrin 3 Containing Mutations Associated with ALS and Distal Myopathy.
26493020 2016 Replication study of MATR3 in familial and sporadic amyotrophic lateral sclerosis.
26129669 2015 Nuclear matrix protein Matrin 3 is a regulator of ZAP-mediated retroviral restriction.
25948554 2015 Disruption of the lamin A and matrin-3 interaction by myopathic LMNA mutations.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25771394 2015 Mutational analysis of MATR3 in Taiwanese patients with amyotrophic lateral sclerosis.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25677933 2015 Impairment of respiratory function in late-onset distal myopathy due to MATR3 Mutation.
25599992 2015 Nuclear matrix protein Matrin3 regulates alternative splicing and forms overlapping regulatory networks with PTB.
25574029 2015 MATR3 disruption in human and mouse associated with bicuspid aortic valve, aortic coarctation and patent ductus arteriosus.
25523636 2015 Mutation analysis of MATR3 in Australian familial amyotrophic lateral sclerosis.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25158920 2014 Genetic analysis of matrin 3 gene in French amyotrophic lateral sclerosis patients and frontotemporal lobar degeneration with amyotrophic lateral sclerosis patients.
25154462 2014 Phenotype of matrin-3-related distal myopathy in 16 German patients.
24686783 2014 Mutations in the Matrin 3 gene cause familial amyotrophic lateral sclerosis.
24558381 2014 pY RNA1-s2: a highly retina-enriched small RNA that selectively binds to Matrin 3 (Matr3).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23158102 2013 HIV-1 pre-mRNA commitment to Rev mediated export through PSF and Matrin 3.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21858232 2011 Matrin 3 binds and stabilizes mRNA.
21771348 2011 Matrin 3 and HIV Rev regulation of mRNA.
21771347 2011 Matrin 3 is a co-factor for HIV-1 Rev in regulating post-transcriptional viral gene expression.
21771346 2011 Characterization of the HIV-1 RNA associated proteome identifies Matrin 3 as a nuclear cofactor of Rev function.
21683594 2011 A study of FHL1, BAG3, MATR3, PTRF and TCAP in Australian muscular dystrophy patients.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21182838 2011 Matrin 3 as a key regulator of endothelial cell survival.
20421735 2010 Involvement of Matrin 3 and SFPQ/NONO in the DNA damage response.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19836620 2009 Body composition and muscular strength changes after moderate activity: association with matrix metalloproteinase polymorphisms.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19562669 2009 Matrin 3: chromosomal distribution and protein interactions.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19344878 2009 Autosomal-dominant distal myopathy associated with a recurrent missense mutation in the gene encoding the nuclear matrix protein, matrin 3.
19240791 2009 Integrated genomic analysis implicates haploinsufficiency of multiple chromosome 5q31.2 genes in de novo myelodysplastic syndromes pathogenesis.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19131338 2009 Identification and characterization of a novel nuclear protein complex involved in nuclear hormone receptor-mediated gene regulation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18618731 2008 Identifying functional neighborhoods within the cell nucleus: proximity analysis of early S-phase replicating chromatin domains to sites of transcription, RNA polymerase II, HP1gamma, matrin 3 and SAF-A.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17658460 2007 Matrin 3 is a Ca2+/calmodulin-binding protein cleaved by caspases.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12927788 2003 hLodestar/HuF2 interacts with CDC5L and is involved in pre-mRNA splicing.
12840015 2003 Nuclear coactivator-62 kDa/Ski-interacting protein is a nuclear matrix-associated coactivator that may couple vitamin D receptor-mediated transcription and RNA splicing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12469345 2002 Manifold decreased protein levels of matrin 3, reduced motor protein HMP and hlark in fetal Down's syndrome brain.
11525732 2001 The fate of dsRNA in the nucleus: a p54(nrb)-containing complex mediates the nuclear retention of promiscuously A-to-I edited RNAs.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9837826 1998 Vocal cord and pharyngeal weakness with autosomal dominant distal myopathy: clinical description and gene localization to 5q31.
9757574 1998 Mapping of human DNA-binding nuclear protein (NP220) to chromosome band 2p13.1-p13.2 and its relation to matrin 3.
9630250 1998 Human U19 intron-encoded snoRNA is processed from a long primary transcript that possesses little potential for protein coding.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
2180926 1990 The nuclear matrix from cells of different origin. Evidence for a common set of matrix proteins.
2033075 1991 Molecular cloning of matrin 3. A 125-kilodalton protein of the nuclear matrix contains an extensive acidic domain.