Property Summary

NCBI Gene PubMed Count 26
PubMed Score 204.23
PubTator Score 73.11

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

PMID Text
24692560 Matrilin-1 is an inhibitor of neovascularization
24469715 this meta-analysis found an overall significant association of rs1149048 polymorphism with risk of AIS, especially in Asian population.
22278929 no significant difference in single nucleotide polymorphism between adolescent idiopathic scoliosis cases and controls
22193623 The A allele of single nucleotide polymorphism rs1065755 in the MATN1 gene is associated with adolescent idiopathic scoliosis.
21308753 we concluded that MATN1 SNP is not associated with either adolescent idiopathic scoliosis predisposition or curve severity in Japanese.
20739701 Genotyping results showed Matrilin-1 polymorphism haplotype TGC (ht4; 158T, 7987G, and 8572C alleles) had pronounced risk effect for mandibular prognathism compared with controls.
20739701 Observational study of gene-disease association. (HuGE Navigator)
20729554 Matrilin-1 A-domains have a role in cartilage ECM assembly
20137728 Genotype GG of matrilin-1 gene is indicative of less bracing effectiveness in adolescent idiopathic scoliosis.
20137399 There is an association between matrilin-1 levels and curve progression in adolescent idiopathic scoliosis.
20092731 The tagSNP rs1149048 polymorphism in the MATN1 promoter region is associated with both susceptibility and disease severity in adolescent idiopathic scoliosis.
20092731 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
18985072 the tagSNP rs1149048 polymorphism in the MATN1 promoter region was associated with both susceptibility and disease progression in adolescent idiopathic scoliosis .
18985072 Observational study of gene-disease association. (HuGE Navigator)
17176459 Observational study of gene-disease association. (HuGE Navigator)
15552564 Pseudoachondroplasia is associated with mutations in the cartilage oligomatrix protein gene.
12175111 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRVLSGTSLMLCSLLLLLQALCSPGLAPQSRGHLCRTRPTDLVFVVDSSRSVRPVEFEKVKVFLSQVIES      1 - 70
LDVGPNATRVGMVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAFGDAEGGRS     71 - 140
RSPDISKVVIVVTDGRPQDSVQDVSARARASGVELFAIGVGSVDKATLRQIASEPQDEHVDYVESYSVIE    141 - 210
KLSRKFQEAFCVVSDLCATGDHDCEQVCISSPGSYTCACHEGFTLNSDGKTCNVCSGGGGSSATDLVFLI    211 - 280
DGSKSVRPENFELVKKFISQIVDTLDVSDKLAQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEK    281 - 350
GTMTGAALKYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFAVGVGNAVEDELR    351 - 420
EIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAI    421 - 490
LENTVV                                                                    491 - 496
//

Text Mined References (27)

PMID Year Title
24692560 2014 Matrilin-1 is an inhibitor of neovascularization.
24469715 2014 The association of rs1149048 polymorphism in matrilin-1(MATN1) gene with adolescent idiopathic scoliosis susceptibility: a meta-analysis.
22278929 2012 Single-nucleotide polymorphism in Turkish patients with adolescent idiopathic scoliosis: curve progression is not related with MATN-1, LCT C/T-13910, and VDR BsmI.
22193623 2012 Associations between matrilin-1 gene polymorphisms and adolescent idiopathic scoliosis curve patterns in a Korean population.
21308753 2011 Lack of association between adolescent idiopathic scoliosis and previously reported single nucleotide polymorphisms in MATN1, MTNR1B, TPH1, and IGF1 in a Japanese population.
20739701 2010 Polymorphisms in the Matrilin-1 gene and risk of mandibular prognathism in Koreans.
20729554 2010 Structural and functional investigations of Matrilin-1 A-domains reveal insights into their role in cartilage ECM assembly.
20137728 2009 [Association between matrilin-1 gene polymorphism and bracing effectiveness in adolescent idiopathic scoliosis girls].
20137399 2009 [Decreased circulating matrilin-1 levels in adolescent idiopathic scoliosis].
20092731 2009 [Association between polymorphism of Matrilin-1 gene (MATN1) with susceptibility to adolescent idiopathic scoliosis].
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
18985072 2009 Promoter polymorphism of matrilin-1 gene predisposes to adolescent idiopathic scoliosis in a Chinese population.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
17176459 2006 Evidence of a linkage between matrilin-1 gene (MATN1) and idiopathic scoliosis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15552564 2004 Mesomelic dwarfism in pseudoachondroplasia.
15075323 2004 Interactions between the cartilage oligomeric matrix protein and matrilins. Implications for matrix assembly and the pathogenesis of chondrodysplasias.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12175111 Association analysis of genotypic frequencies of matrilin-1 gene in patients with osteoarthritis.
11896063 2002 Characterization of the matrilin coiled-coil domains reveals seven novel isoforms.
11882030 2002 Extra-articular cartilage affected in collagen-induced, but not pristane-induced, arthritis models.
10196235 1999 Enhancement of cell adhesion and spreading by a cartilage-specific noncollagenous protein, cartilage matrix protein (CMP/Matrilin-1), via integrin alpha1beta1.
9083061 1997 Primary structure and expression of matrilin-2, the closest relative of cartilage matrix protein within the von Willebrand factor type A-like module superfamily.
7989046 1994 Exclusion of the cartilage link protein and the cartilage matrix protein genes as the mutant loci in several heritable chondrodysplasias.
2246248 1990 Structure and chromosomal location of the human gene encoding cartilage matrix protein.