Property Summary

NCBI Gene PubMed Count 43
PubMed Score 745.73
PubTator Score 576.60

Knowledge Summary

Patent (43,586)

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.400 5.4e-06
glioblastoma -2.500 7.4e-07
medulloblastoma -2.000 7.2e-05
astrocytoma -1.200 7.3e-03
atypical teratoid / rhabdoid tumor -2.200 9.3e-10
primitive neuroectodermal tumor -2.000 2.2e-04
adult high grade glioma -2.400 1.7e-05
pilocytic astrocytoma -2.000 1.6e-06

Gene RIF (13)

PMID Text
21799000 After IGF-I stimulation, CTK is recruited to IGF-IR and its recruitment facilitates CTK's subsequent association with phospho-SHPS-1.
18292939 CHK is capable of inhibiting the CXCL12-CXCR4 pathway in neuroblastoma.
17934522 These results reveal a potentially important role for CHK in Src activation and tumorigenicity in colon cancer cells.
17492661 Progesterone increases MATK in mast cells and reducs cell proliferation.
16707123 Findings indicate that the importance of the N-terminal domain to Chk-induced tyrosine phosphorylation in the nucleus, and implicate that nuclear tyrosine-phosphorylated proteins may contribute to inhibition of cell proliferation.
16574955 Matk/CHK is not functionally redundant with Csk, and this tyrosine kinase plays an important role as a regulator of immunologic responses
16168623 This study describes for the first time the Src-independent actions of CHK and provides novel insights into CHK function in neural cells.
15890649 striking functional differences between the Csk and Chk SH2 domains and revealed functional similarities between the Chk and Src SH2 domains
15748901 Nuclear multi-lobulation in late S phase, which is dependent on polymerization and depolymerization of microtubules, may be involved in nuclear Chk-induced inhibition of proliferation.
15329911 Loss of CHK expression is associated with human brain tumors
12782282 CHK Leu223 stabilizes the movement of the alphaC-helix of the protein tyrosine kinase
12429987 Overexpression of the Csk homologous kinase facilitates phosphorylation of akt/protein kinase b in breast neoplasms
12122014 ERBB2 binds to the SH2 domain of CHK and inhibits cell growth in human breast tumor cell lines

AA Sequence

MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHTRPKPGELAFR      1 - 70
KGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPE     71 - 140
DGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRP    141 - 210
KRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVM    211 - 280
TKMQHENLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVH    281 - 350
RDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSY    351 - 420
GRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPAS    421 - 490
VSGQDADGSTSPRSQEP                                                         491 - 507
//

Text Mined References (52)

PMID Year Title
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24510904 2014 Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
21799000 2011 IGF-I stimulates cooperative interaction between the IGF-I receptor and CSK homologous kinase that regulates SHPS-1 phosphorylation in vascular smooth muscle cells.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18292939 2008 Csk homologous kinase inhibits CXCL12-CXCR4 signaling in neuroblastoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17934522 2008 Decreased CHK protein levels are associated with Src activation in colon cancer cells.
17492661 2007 Progesterone increases csk homologous kinase in HMC-1560 human mast cells and reduces cell proliferation.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16707123 2006 Involvement of the N-terminal unique domain of Chk tyrosine kinase in Chk-induced tyrosine phosphorylation in the nucleus.
16574955 2006 Identification of the nonreceptor tyrosine kinase MATK/CHK as an essential regulator of immune cells using Matk/CHK-deficient mice.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16168623 2006 Csk homologous kinase (CHK), unlike Csk, enhances MAPK activation via Ras-mediated signaling in a Src-independent manner.
16129412 2005 Signaling by Kit protein-tyrosine kinase--the stem cell factor receptor.
15890649 2005 Functional diversity of Csk, Chk, and Src SH2 domains due to a single residue variation.
15748901 2005 Multi-lobulation of the nucleus in prolonged S phase by nuclear expression of Chk tyrosine kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15329911 2004 Differential expression of Csk homologous kinase (CHK) in normal brain and brain tumors.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12782282 2003 Conserved hydrophobicity in the SH2-kinase linker is required for catalytic activity of Csk and CHK.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429987 2002 Overexpression of the Csk homologous kinase facilitates phosphorylation of Akt/PKB in MCF-7 cells.
12122014 2002 Csk homologous kinase (CHK) and ErbB-2 interactions are directly coupled with CHK negative growth regulatory function in breast cancer.
12063569 2002 Csk homologous kinase associates with RAFTK/Pyk2 in breast cancer cells and negatively regulates its activation and breast cancer cell migration.
10329710 1999 The Csk homologous kinase associates with TrkA receptors and is involved in neurite outgrowth of PC12 cells.
10080957 1999 The Csk homologous kinase, Chk, binds tyrosine phosphorylated paxillin in human blastic T cells.
9255603 1997 The Csk-like proteins Lsk, Hyl, and Matk represent the same Csk homologous kinase (Chk) and are regulated by stem cell factor in the megakaryoblastic cell line MO7e.
9171348 1997 Translocation of the Csk homologous kinase (Chk/Hyl) controls activity of CD36-anchored Lyn tyrosine kinase in thrombin-stimulated platelets.
9038210 1997 Direct association of Csk homologous kinase (CHK) with the diphosphorylated site Tyr568/570 of the activated c-KIT in megakaryocytes.
8999872 1997 Association of csk-homologous kinase (CHK) (formerly MATK) with HER-2/ErbB-2 in breast cancer cells.
8288563 1994 Identification and characterization of a novel tyrosine kinase from megakaryocytes.
8134117 1994 Molecular cloning of a novel non-receptor tyrosine kinase, HYL (hematopoietic consensus tyrosine-lacking kinase).
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7936664 1994 Characterization of mouse non-receptor tyrosine kinase gene, HYL.
7536744 1995 The MATK tyrosine kinase interacts in a specific and SH2-dependent manner with c-Kit.
7530249 1995 Structural and functional studies of the intracellular tyrosine kinase MATK gene and its translated product.
7516063 1994 Molecular cloning of lsk, a carboxyl-terminal src kinase (csk) related gene, expressed in leukocytes.
1722201 1991 CSK: a protein-tyrosine kinase involved in regulation of src family kinases.