Property Summary

NCBI Gene PubMed Count 37
PubMed Score 75.48
PubTator Score 59.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.459 2.5e-03
astrocytic glioma 1.400 3.1e-02
oligodendroglioma 1.300 9.2e-03
osteosarcoma 2.763 1.2e-05
ependymoma 1.700 2.0e-06
group 4 medulloblastoma 2.200 3.6e-04
atypical teratoid / rhabdoid tumor 1.900 1.2e-03
glioblastoma 1.800 1.8e-03
medulloblastoma, large-cell 3.000 1.3e-05
primitive neuroectodermal tumor 1.100 2.5e-03
primary pancreatic ductal adenocarcinoma -1.146 4.1e-02
non-small cell lung cancer -1.039 1.4e-18
pediatric high grade glioma 1.300 7.4e-03
lung adenocarcinoma 1.035 5.3e-06
COPD -1.100 3.0e-03
Alzheimer's disease -1.200 3.6e-02
Pick disease -1.700 1.3e-05
progressive supranuclear palsy -1.500 9.7e-03
Down syndrome 1.300 1.8e-03
chronic rhinosinusitis -1.197 1.8e-02
pancreatic cancer -1.100 2.8e-02
dermatomyositis 1.300 1.8e-04

Protein-protein Interaction (3)

Gene RIF (27)

PMID Text
26858410 crystal structures of human MATalpha2 containing various bound ligands.
25925782 acetylation decreased in hepatocellular cancer
25557781 The data presented here support the conclusion that rare genetic variants in MAT2A predispose individuals to thoracic aortic disease.
25294683 Mutagenesis of MATalpha2 and MATbeta phospho-sites destabilized them and prevented hepatic stellate cell trans-differentiation.
24636201 Results suggest that MAT2A is downregulated in cancer tissues of renal cell carcinomas patients and has function of tumor suppressor though repressing the expression of heme oxygenase-1.
23425511 Liver-specific isoenzyme MAT1A is genetically linked with an inborn metabolic disorder of hypermethioninemia, as well as a ubiquitously expressed isoenzyme MAT2A, whose enzymatic activity is regulated by an associated subunit MAT2B.
22879628 Differential gene expression of BACE1 and PSEN1 in the knockdown cells, which is possibly a consequence of MAT2A deregulation and may indicate a self regulatory mechanism.
22318685 we found for the first time a post-transcriptional regulation of MAT1A and MAT2A by AUF1 and HuR in hepatocellular carcinoma.
21460102 hypoxia-induced MAT2A expression is HIF-1alpha dependent
21406062 Insulin-like growth factor 1 (IGF1) activates methionine adenosyltransferase 2A MAT2A) transcription by both known and novel pathways in colon cancer cells.
21362551 Methionine adenosyltransferase II serves as a transcriptional corepressor of Maf oncoprotein
21247894 X protein of hepatitis B virus inhibits apoptosis in hepatoma cells through enhancing the methionine adenosyltransferase 2A gene expression and reducing S-adenosylmethionine production
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20615890 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19683694 Observational study of gene-disease association. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19048023 This work was carried out to examine the role of MAT II activity and S-adenosylmethionine biosynthesis in the survival of leukemic T cells.
18854154 Knockdown of methionine adenosyltransferase II, alpha (MAT2A) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18423013 Observational study of gene-disease association. (HuGE Navigator)
18041713 Lower expression of both MAT2A and MAT2beta and interfere with leptin signaling in liver cancer cells.
17631143 up-regulation of MAT2A also provides a growth advantage and s-adenosylmethionine and methylthioadenosine can block mitogenic signaling in colon cancer cells
14530285 NF-kappa B and AP-1 are required for basal MAT2A expression in HepG2 cells and mediate the increase in MAT2A expression in response to TNF-alpha
12671891 beta subunit associates with cirrhosis and cancer providing a proliferative advantage in hepatoma cells through its interaction with methionine adenosyltransferase II alpha2 and down-regulation of S-adenosylmethionine levels.
12660248 regulation of expression in hepatocarcinoma cells by L-methionine availability

AA Sequence

MNGQLNGFHEAFIEEGTFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVAKTGMILLAGE      1 - 70
ITSRAAVDYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGVHLDRNEEDIGAGDQGLMFG     71 - 140
YATDETEECMPLTIVLAHKLNAKLAELRRNGTLPWLRPDSKTQVTVQYMQDRGAVLPIRVHTIVISVQHD    141 - 210
EEVCLDEMRDALKEKVIKAVVPAKYLDEDTIYHLQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGG    211 - 280
AFSGKDYTKVDRSAAYAARWVAKSLVKGGLCRRVLVQVSYAIGVSHPLSISIFHYGTSQKSERELLEIVK    281 - 350
KNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLKY                             351 - 395
//

Text Mined References (43)

PMID Year Title
26858410 2016 Crystallography captures catalytic steps in human methionine adenosyltransferase enzymes.
25925782 2015 Acetylation of MAT II? represses tumour cell growth and is decreased in human hepatocellular cancer.
25557781 2015 MAT2A mutations predispose individuals to thoracic aortic aneurysms.
25416956 2014 A proteome-scale map of the human interactome network.
25294683 2015 Role of methionine adenosyltransferase ?2 and ? phosphorylation and stabilization in human hepatic stellate cell trans-differentiation.
25075345 2014 Structure and function study of the complex that synthesizes S-adenosylmethionine.
24636201 2014 Expression of methionine adenosyltransferase 2A in renal cell carcinomas and potential mechanism for kidney carcinogenesis.
23425511 2013 Insight into S-adenosylmethionine biosynthesis from the crystal structures of the human methionine adenosyltransferase catalytic and regulatory subunits.
23189196 2012 NADP+ binding to the regulatory subunit of methionine adenosyltransferase II increases intersubunit binding affinity in the hetero-trimer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22879628 2012 The amyloid precursor protein (APP) family members are key players in S-adenosylmethionine formation by MAT2A and modify BACE1 and PSEN1 gene expression-relevance for Alzheimer's disease.
22318685 2012 Role of transcriptional and posttranscriptional regulation of methionine adenosyltransferases in liver cancer progression.
21460102 2011 Hypoxia induces genomic DNA demethylation through the activation of HIF-1? and transcriptional upregulation of MAT2A in hepatoma cells.
21406062 2011 Insulin-like growth factor 1 activates methionine adenosyltransferase 2A transcription by multiple pathways in human colon cancer cells.
21362551 2011 Methionine adenosyltransferase II serves as a transcriptional corepressor of Maf oncoprotein.
21269460 2011 Initial characterization of the human central proteome.
21247894 2011 The X protein of hepatitis B virus inhibits apoptosis in hepatoma cells through enhancing the methionine adenosyltransferase 2A gene expression and reducing S-adenosylmethionine production.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20615890 2010 A candidate gene study of folate-associated one carbon metabolism genes and colorectal cancer risk.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19683694 2009 Genetic association study of putative functional single nucleotide polymorphisms of genes in folate metabolism and spina bifida.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
19048023 2009 Inhibition of methionine adenosyltransferase II induces FasL expression, Fas-DISC formation and caspase-8-dependent apoptotic death in T leukemic cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18423013 2008 Implication of Xenobiotic Metabolizing Enzyme gene (CYP2E1, CYP2C19, CYP2D6, mEH and NAT2) polymorphisms in breast carcinoma.
18041713 2008 Leptin's mitogenic effect in human liver cancer cells requires induction of both methionine adenosyltransferase 2A and 2beta.
17631143 2007 Role of methionine adenosyltransferase 2A and S-adenosylmethionine in mitogen-induced growth of human colon cancer cells.
16413417 2006 Activation of a novel isoform of methionine adenosyl transferase 2A and increased S-adenosylmethionine turnover in lung epithelial cells exposed to hyperoxia.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14530285 2003 Induction of human methionine adenosyltransferase 2A expression by tumor necrosis factor alpha. Role of NF-kappa B and AP-1.
12671891 2003 Methionine adenosyltransferase II beta subunit gene expression provides a proliferative advantage in human hepatoma.
12660248 2003 L-methionine availability regulates expression of the methionine adenosyltransferase 2A gene in human hepatocarcinoma cells: role of S-adenosylmethionine.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10644686 2000 Cloning, expression, and functional characterization of the beta regulatory subunit of human methionine adenosyltransferase (MAT II).
9703951 1998 Cloning and functional characterization of the 5'-flanking region of human methionine adenosyltransferase 2A gene.
7665609 1995 Chromosomal localization and catalytic properties of the recombinant alpha subunit of human lymphocyte methionine adenosyltransferase.
7213623 1981 Multiple species of mammalian S-adenosylmethionine synthetase. Partial purification and characterization.
1426236 1992 Molecular cloning and developmental expression of a human kidney S-adenosylmethionine synthetase.