Property Summary

Ligand Count 1
NCBI Gene PubMed Count 7
PubMed Score 8.03
PubTator Score 5.44

Knowledge Summary

Patent (1,278)

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.300 3.1e-03
astrocytic glioma -1.400 1.2e-02
Astrocytoma, Pilocytic -2.100 1.1e-04
atypical teratoid / rhabdoid tumor -3.100 1.1e-08
ependymoma -1.700 4.7e-03
glioblastoma -2.100 1.9e-06
group 3 medulloblastoma -2.300 2.1e-02
malignant mesothelioma -1.100 1.0e-05
medulloblastoma, large-cell -3.700 4.7e-04
oligodendroglioma -2.000 2.7e-20
osteosarcoma -2.327 2.2e-06
Pick disease -1.100 4.0e-02
primitive neuroectodermal tumor -2.700 6.9e-04
tuberculosis 1.200 6.6e-05

Gene RIF (1)

AA Sequence

MDESSLLRRRGLQKELSLPRRGRGCRSGNRKSLVVGTPSPTLSRPLSPLSVPTAGSSPLDSPRNFSAASA      1 - 70
LNFPFARRADGRRWSLASLPSSGYGTNTPSSTLSSSSSSRERLHQLPFQPTPDELHFLSKHFRSSENVLD     71 - 140
EEGGRSPRLRPRSRSLSPGRATGTFDNEIVMMNHVYRERFPKATAQMEGRLQEFLTAYAPGARLALADGV    141 - 210
LGFIHHQIVELARDCLAKSGENLVTSRYFLEMQEKLERLLQDAHERSDSEEVSFIVQLVRKLLIIISRPA    211 - 280
RLLECLEFDPEEFYHLLEAAEGHAREGQGIKTDLPQYIIGQLGLAKDPLEEMVPLSHLEEEQPPAPESPE    281 - 350
SRALVGQSRRKPCESDFETIKLISNGAYGAVYLVRHRDTRQRFAIKKINKQNLILRNQIQQVFVERDILT    351 - 420
FAENPFVVSMFCSFETRRHLCMVMEYVEGGDCATLLKNMGPLPVDMARLYFAETVLALEYLHNYGIVHRD    421 - 490
LKPDNLLITSLGHIKLTDFGLSKIGLMSMATNLYEGHIEKDAREFIDKQVCGTPEYIAPEVIFRQGYGKP    491 - 560
VDWWAMGVVLYEFLVGCVPFFGDTPEELFGQVVSDEIMWPEGDEALPADAQDLITRLLRQSPLDRLGTGG    561 - 630
THEVKQHPFFLALDWAGLLRHKAEFVPQLEAEDDTSYFDTRSERYRHLGSEDDETNDEESSTEIPQFSSC    631 - 700
SHRFSKVYSSSEFLAVQPTPTFAERSFSEDREEGWERSEVDYGRRLSADIRLRSWTSSGSSCQSSSSQPE    701 - 770
RGPSPSLLNTISLDTMPKFAFSSEDEGVGPGPAGPKRPVFILGEPDPPPAATPVMPKPSSLSADTAALSH    771 - 840
ARLRSNSIGARHSTPRPLDAGRGRRLGGPRDPAPEKSRASSSGGSGGGSGGRVPKSASVSALSLIITADD    841 - 910
GSGGPLMSPLSPRSLSSNPSSRDSSPSRDPSPVCGSLRPPIVIHSSGKKYGFSLRAIRVYMGDSDVYTVH    911 - 980
HVVWSVEDGSPAQEAGLRAGDLITHINGESVLGLVHMDVVELLLKSGNKISLRTTALENTSIKVGPARKN    981 - 1050
VAKGRMARRSKRSRRRETQDRRKSLFKKISKQTSVLHTSRSFSSGLHHSLSSSESLPGSPTHSLSPSPTT   1051 - 1120
PCRSPAPDVPADTTASPPSASPSSSSPASPAAAGHTRPSSLHGLAAKLGPPRPKTGRRKSTSSIPPSPLA   1121 - 1190
CPPISAPPPRSPSPLPGHPPAPARSPRLRRGQSADKLGTGERLDGEAGRRTRGPEAELVVMRRLHLSERR   1191 - 1260
DSFKKQEAVQEVSFDEPQEEATGLPTSVPQIAVEGEEAVPVALGPTGRD                        1261 - 1309
//

Text Mined References (14)

PMID Year Title