Property Summary

NCBI Gene PubMed Count 106
PubMed Score 173.88
PubTator Score 177.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.225 1.0e-02
lung cancer -1.400 3.0e-03
Breast cancer -2.300 5.0e-07
psoriasis -1.100 4.6e-29

Gene RIF (89)

PMID Text
26728378 Data show that the vector expressing mannose-binding lectin associated protein 19 (MAp19) has been prepared successfully, and can express the target protein (MAp19) in the eukaryotic cells (HeLa cells).
26382056 MBL2 and MASP2 deficiencies protect against the development of systemic inflammatory response after pediatric cardiac surgery.
25887173 Polymorphisms of mannose-binding lectin (rs7096206) and MASP-2 (rs2273346 and rs6695096) were associated with the susceptibility of tuberculosis, and there were gene-gene interactions among them.
25862418 Polymorphisms in MASP1 and MASP2 genes are associated with the susceptibility or protection to infectious diseases. (Review)
25533914 Because MASP-1 and MASP-2 have been shown to interact directly with blood coagulation, elevated levels of these proteins may play a role in the enhanced thrombotic environment and consequent vascular complications in diabetes.
25359215 TFPI inhibits lectin pathway of complement activation by direct interaction with MASP-2.
25318078 MASP2 gene polymorphisms and protein levels seem to play an important role in the development of rheumatic fever and establishment of rheumatic heart disease.
25312983 polymorphism of MASP-2 (rs6695096) gene was associated with susceptibility to tuberculosis.
25042985 Both ficolin-3 and MASP-2 levels correlated inversely with the time from the onset of the attack of hereditary angioedema until blood sampling
25038892 expression of MBL and MASP-2 is altered in ovarian cancer, possibly indicating involvement of the lectin pathway of complement activation in the disease
24856568 Bipolar disorder is associated with the MBL2 LXPA haplotype and lower MASP-2 levels.
24632598 Study found the first evidence that MASP-2 deficiency might play an important role in the development of RA and articular symptoms among relatives of RA patients.
24424083 Data indicate that MASP-1 and MASP-2 can readily form heterodimers after dissociation and re-association, however, in the presence of Ca(2+) exchange of subunits is slow between the homodimers.
24227370 results show that SNPS in MASP2 are significantly more susceptible to infectious complications, SIRS and septic shock.
23935922 low MASP-2 levels increase the susceptibility to leprosy in general and to lepromatous leprosy in particular. MASP2 genotypes and MASP-2 levels might thus be of prognostic value for leprosy progression.
23911397 Studies indicate that initiation of lectin compleme pathway leads to activation of the serine proteases MASP-1 and MASP-2 resulting in deposition of C4 on the activator and assembly of the C3 convertase.
23861212 The present study describes an association between a polymorphism in the MASP2 gene and susceptibility to HTLV-1 infection, and provides further evidence of an association between the MBL2 gene and HTLV-1 infection.
23785123 In this study, we demonstrate that, although MASPs do not directly form heterodimers, the addition of mannan-binding lectin or ficolins allows the formation of MASP-1-MASP-2 co-complexes.
23402018 MASP-2 is a key enzyme that cleaves C4 and C2 to assemble a C3 convertase--{review}
23220946 collectin-11 associates with all the known MBL-associated serine proteases (MASP-1, MASP-2 and MASP-3) as well as the lectin complement pathway regulator MAP-1.
23142462 Data indicate that the median concentration of MASP-2/ficolin-3 complexes was 119.7 AU/ml (range: 2.9-615.5 AU/ml).
22966085 A crucial role of MASP-1 is demonstrated in the activation of MASP-2, as well as of MASP-3, based on a patient harboring a nonsense mutation in the common part of the MASP1 gene.
22691502 MASP-1 activates MASP-2 and, moreover, inhibition of MASP-1 prevents autoactivation of MASP-2
22511776 Monospecific inhibitors show that both mannan-binding lectin-associated serine protease-1 (MASP-1) and -2 Are essential for lectin pathway activation and reveal structural plasticity of MASP-2.
22380611 A common MASP2 mutation (R439H, rs12085877), was protective against placental malaria and occurred in 33% of non-affected women.
22236007 In patients with haematological malignancy undergoing chemotherapy, those with low M-ficolin levels were more likely to develop severe infections.
22178059 MASP-2 levels in the peripheral circulation are significantly reduced in myocardial infarction (MI) patients compared with those of healthy individuals or of coronary artery disease (CAD) patients without acute MI.
22173059 Data show no association of donor and recipient MBL2 and MASP2 genotype with allograft outcome, and analysis of SNPs and haplotypes in the FCN2 gene of the donor and recipient did not reveal an association with transplant outcome.
22071314 Interactions required for the cleavage of C4 by MASP-2 are likely to be facilitated by the initial binding of C4 to an exosite on the protease.
21974696 It is postulated that the elevation of concentration of the two components of the leptin pathway, L-ficolin and MASP-2, may compensate for the insufficient activity of the LP in mannose-binding lectin deficiency.
21926545 Results suggest that MBL and MASP-2 play only a minor role in the inflammatory response in acute pancreatitis.
21871896 Data show that both MAp19 and MASP-2 were mainly expressed in hepatocytes.
21843573 MASP2 gene polymorphism is associated with susceptibility to hepatitis C virus infection.
21489885 MASP2*CD genotypes, most of them generating low MASP-2 levels, are associated with high risk of chagasic cardiomyopathy
21203938 binding of Mannan Binding Lectin to hepatitis C virus glycoproteins was able to activate the complement system via MBL-associated serine protease 2
21198752 In contrast to what has been demonstrated for serum levels of mannan-binding lectin (MBL) and MBL-associated serine protease 2, the genotypes do not predict disease course of the colorectal cancer patients
20817870 MASP-1 has a crucial role in the initiation steps of lectin pathway activation most probably by activating MASP-2
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20593422 Donor and recipient gene polymorphisms in the lectin complement pathway (MBL2, FCN2, MASP2) are major determinants of the risk of clinically significant bacterial infection and mortality after orthotopic liver transplantation.
20593422 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20150204 Observational study of gene-disease association. (HuGE Navigator)
20042521 the outcome of intensive care unit (ICU) patients with systemic inflammatory response syndrome (SIRS) regarding the existence of functionally relevant MBL2 and MASP2 gene polymorphisms was studied
20042521 Observational study of gene-disease association. (HuGE Navigator)
20002787 The MASP2-mediated release of FPA and FPB may play a role in early immune activation. Additionally, MASP-catalysed deposition and polymerization of fibrin on the surface of micro-organisms may be protective by limiting the dissemination of infection.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19817957 Observational study of gene-disease association. (HuGE Navigator)
19775369 Observational study of genotype prevalence. (HuGE Navigator)
19737459 SARS-CoV N interacts with MAP19 and increased the expression of MAP19 in cells.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19405982 There is no association between MASP2 polymorphisms and susceptibility to SARS coronavirus infection.
19405982 Observational study of gene-disease association. (HuGE Navigator)
19344414 Observational study of gene-disease association. (HuGE Navigator)
19307021 Serum MASP-2 concentrations correlated with gestational age and birthweight and were significantly lower in premature babies and other pre-term babies compared with term babies.
19275590 Observational study of gene-disease association. (HuGE Navigator)
19234189 Naturally occurring variant forms of MASP-2 differ in mannan-binding lectin activity and enzymatic activity and may have implications for susceptibility to infections of individuals with various genotypes.
19234189 Observational study of genotype prevalence. (HuGE Navigator)
19050632 Observational study of gene-disease association. (HuGE Navigator)
18849076 Poly(ethylene glycol)s generate complement activation products in human serum through increased alternative pathway turnover and a MASP-2-dependent process
18842294 Observational study of gene-disease association. (HuGE Navigator)
18638656 High postoperative levels of MASP-2 are associated with poor prognosis in patients curatively resected for colorectal cancer
18596574 Infants later developing necrotising enterocolitis had significantly higher MASP-2 cord blood levels compared with controls.
18582923 MASP2 alleles and genotypes did not associate with any measurment of severity or outcome of community-acquired pneumonia
18582923 Observational study of gene-disease association. (HuGE Navigator)
18400978 No association with aortic regurgitation of rheumatic etiology was detected with the variant of the MASP2 gene.
18295674 Results suggest that the D105G mutation in the MASP2 gene does not play a major role in the pathogenesis of rheumatic fever.
18295674 Observational study of gene-disease association. (HuGE Navigator)
18221301 Our data do not seem to suggest a role for MBL2 and MASP2 polymorphisms in HCC susceptibility either for HBV-HCV infection-dependent HCC or for HCC raised as a consequence of exposure to different risk factors.
18221301 Observational study of gene-disease association. (HuGE Navigator)
18177377 Data show that interaction of calreticulin with recombinant MBL was fully inhibited by recombinant MASP-2, but not by the MASP-2 D105G variants characterized by defective MBL binding ability.
17984804 In this study, MASP-2 deficiency was associated with an increased risk of fever and neutropenia in children treated with chemotherapy for cancer.
17971300 We conclude that Stat3 binding is important for MASP2 promoter activity.
17709141 MASP-2 is a major physiological target of C1-inhibitor.
17614162 Observational study of gene-disease association. (HuGE Navigator)
17565323 Observational study of gene-disease association. (HuGE Navigator)
17303612 Observational study of gene-disease association. (HuGE Navigator)
17303612 variations in MASP2 appear to be of limited importance in the pathogenesis of Crohn's disease
17252003 MASP-2 present in individuals homozygous for p.377A or p.99Q had a normal enzyme activity whereas MASP-2 in individuals homozygous for p.126L was non-functional
17096357 The data indicate a strong genetic influence for the serum levels of MBL and for MASP-2 activity with a significant genetic correlation between the two traits.
17045845 Concentrations and genotypes of MASP-2 and mannan-binding lectin in 109 cystic fibrosis patients were correlated to lung function and chronic infections
16395704 MASP-2 expression in ESCCs was associated with late clinical stage (p = 0.009, O.R. = 3.430) and nodal metastasis (p = 0.001, O.R. = 4.520).
16112196 The mRNA distribution of masp1 and masp2 were found very similar to that of mbl2, while masp3 mRNA seemed ubiquitous present at quite high levels when compared to liver
16040602 Structural insights are presented into MASP2 autoactivation.
16029433 Observational study of genotype prevalence. (HuGE Navigator)
15746044 MASP-2 concentration in serum proved to be an independent prognostic marker with high MASP-2 levels predicting recurrence and poor survival.
15117939 Results describe the x-ray structure of human mannan-binding lectin-associated protein 19 (MAp19), and identify the residues involved in the interaction of MAp19 with mannan-binding lectin and L-ficolin.
12421953 The interaction of recombinant MASP2, its N-terminal complement modules, and MBL-associated protein 19 with L-ficolin/p35 has been characterized by surface plasmon resonance spectroscopy.

AA Sequence

MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSH      1 - 70
LCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDID     71 - 140
ECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSS    141 - 210
CTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVT    211 - 280
DESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQK    281 - 350
DGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTS    351 - 420
SKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKH    421 - 490
DASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAES    491 - 560
FMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCR    561 - 630
GDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF                  631 - 686
//

Text Mined References (109)

PMID Year Title
26728378 2016 [Expression of mannose-binding lectin associated protein 19 (MAp19) in HeLa cells].
26382056 2016 Mannose-binding lectin (MBL) insufficiency protects against the development of systemic inflammatory response after pediatric cardiac surgery.
25930971 2015 A homozygous mutation in SLC1A4 in siblings with severe intellectual disability and microcephaly.
25887173 2015 Impact of MBL and MASP-2 gene polymorphism and its interaction on susceptibility to tuberculosis.
25862418 2015 MBL-associated serine proteases (MASPs) and infectious diseases.
25533914 2015 Plasma levels of mannan-binding lectin-associated serine proteases MASP-1 and MASP-2 are elevated in type 1 diabetes and correlate with glycaemic control.
25359215 2015 TFPI inhibits lectin pathway of complement activation by direct interaction with MASP-2.
25318078 2014 Association of MASP2 polymorphisms and protein levels with rheumatic fever and rheumatic heart disease.
25312983 2014 Impact of passive smoking, cooking with solid fuel exposure, and MBL/MASP-2 gene polymorphism upon susceptibility to tuberculosis.
25042985 2014 Activation of the ficolin-lectin pathway during attacks of hereditary angioedema.
25038892 2014 Mannose-Binding Lectin (MBL) and MBL-associated serine protease-2 (MASP-2) in women with malignant and benign ovarian tumours.
24856568 2014 Bipolar and panic disorders may be associated with hereditary defects in the innate immune system.
24632598 2014 Association of MASP-2 levels and MASP2 gene polymorphisms with rheumatoid arthritis in patients and their relatives.
24424083 2014 Dissociation and re-association studies on the interaction domains of mannan-binding lectin (MBL)-associated serine proteases, MASP-1 and MASP-2, provide evidence for heterodimer formation.
24227370 2013 Risk of infection and sepsis in severely injured patients related to single nucleotide polymorphisms in the lectin pathway.
23935922 2013 Leprosy association with low MASP-2 levels generated by MASP2 haplotypes and polymorphisms flanking MAp19 exon 5.
23911397 2013 Toward a structure-based comprehension of the lectin pathway of complement.
23861212 2013 Mannose binding lectin and mannose binding lectin-associated serine protease-2 genes polymorphisms in human T-lymphotropic virus infection.
23785123 2013 Co-complexes of MASP-1 and MASP-2 associated with the soluble pattern-recognition molecules drive lectin pathway activation in a manner inhibitable by MAp44.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23402018 2013 The role of MASP-1/3 in complement activation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23220946 2013 Collectin-11/MASP complex formation triggers activation of the lectin complement pathway--the fifth lectin pathway initiation complex.
23142462 2013 A novel assay to quantitate MASP-2/ficolin-3 complexes in serum.
22966085 2012 Mannan-binding lectin-associated serine protease (MASP)-1 is crucial for lectin pathway activation in human serum, whereas neither MASP-1 nor MASP-3 is required for alternative pathway function.
22949645 2012 Structural basis for activation of the complement system by component C4 cleavage.
22691502 2012 Revised mechanism of complement lectin-pathway activation revealing the role of serine protease MASP-1 as the exclusive activator of MASP-2.
22511776 2012 Monospecific inhibitors show that both mannan-binding lectin-associated serine protease-1 (MASP-1) and -2 Are essential for lectin pathway activation and reveal structural plasticity of MASP-2.
22380611 2012 Mutations of complement lectin pathway genes MBL2 and MASP2 associated with placental malaria.
22236007 2012 M-ficolin levels are associated with the occurrence of severe infections in patients with haematological cancer undergoing chemotherapy.
22178059 2013 MASP-2 activation is involved in ischemia-related necrotic myocardial injury in humans.
22173059 2012 Lectin complement pathway gene profile of the donor and recipient does not influence graft outcome after kidney transplantation.
22071314 2012 Multiple domains of MASP-2, an initiating complement protease, are required for interaction with its substrate C4.
21974696 2011 Serum concentration of complement components of the lectin pathway in maintenance hemodialysis patients, and relatively higher levels of L-Ficolin and MASP-2 in Mannose-binding lectin deficiency.
21926545 2011 Mannan-binding lectin and mannan-binding lectin-associated serine protease 2 in acute pancreatitis.
21871896 2011 MAp19, the alternative splice product of the MASP2 gene.
21843573 2011 MASP2 gene polymorphism is associated with susceptibility to hepatitis C virus infection.
21489885 2011 MASP2 haplotypes are associated with high risk of cardiomyopathy in chronic Chagas disease.
21203938 2010 Specific interaction of hepatitis C virus glycoproteins with mannan binding lectin inhibits virus entry.
21198752 2011 Mannan-binding lectin (MBL) and MBL-associated serine protease 2 (MASP-2) genotypes in colorectal cancer.
20817870 2010 Selective inhibition of the lectin pathway of complement with phage display selected peptides against mannose-binding lectin-associated serine protease (MASP)-1 and -2: significant contribution of MASP-1 to lectin pathway activation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20593422 2010 Lectin complement pathway gene profile of donor and recipient determine the risk of bacterial infections after orthotopic liver transplantation.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20150204 2010 Serotype-specific pneumococcal disease may be influenced by mannose-binding lectin deficiency.
20042521 2010 Genotypes coding for low serum levels of mannose-binding lectin are underrepresented among individuals suffering from noninfectious systemic inflammatory response syndrome.
20002787 2010 Activation of mannan-binding lectin-associated serine proteases leads to generation of a fibrin clot.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19775369 2009 Genetic and structural analysis of MBL2 and MASP2 polymorphisms in south-eastern African children.
19737459 2009 [Study on interaction between SARS-CoV N and MAP19].
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19405982 2009 Lack of association between polymorphisms of MASP2 and susceptibility to SARS coronavirus infection.
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
19307021 2009 Mannan-binding lectin-associated serine protease-2 (MASP-2) in a large cohort of neonates and its clinical associations.
19275590 2009 Polymorphic receptors of the innate immune system (MBL/MASP-2 and TLR2/4) and susceptibility to pneumococcal bacteremia in HIV-infected patients: a case-control study.
19234189 2009 Polymorphisms in mannan-binding lectin (MBL)-associated serine protease 2 affect stability, binding to MBL, and enzymatic activity.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19050632 2009 Polymorphisms in innate immunity genes predispose to bacteremia and death in the medical intensive care unit.
18849076 2008 Poly(ethylene glycol)s generate complement activation products in human serum through increased alternative pathway turnover and a MASP-2-dependent process.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18638656 2008 Pre- and postoperative levels in serum of mannan-binding lectin associated serine protease-2 -a prognostic marker in colorectal cancer.
18596574 2008 Higher cord blood levels of mannose-binding lectin-associated serine protease-2 in infants with necrotising enterocolitis.
18582923 2008 Mannose-binding lectin and mannose-binding lectin-associated serine protease 2 in susceptibility, severity, and outcome of pneumonia in adults.
18400978 2008 Association of mannose-binding lectin gene polymorphism but not of mannose-binding serine protease 2 with chronic severe aortic regurgitation of rheumatic etiology.
18295674 2008 Functional MASP2 gene polymorphism in patients with history of rheumatic fever.
18221301 2008 MBL2 and MASP2 gene polymorphisms in patients with hepatocellular carcinoma.
18177377 2008 The chaperone and potential mannan-binding lectin (MBL) co-receptor calreticulin interacts with MBL through the binding site for MBL-associated serine proteases.
17984804 2007 Deficiency of mannose-binding lectin-associated serine protease-2 associated with increased risk of fever and neutropenia in pediatric cancer patients.
17971300 2007 Stat3 is involved in control of MASP2 gene expression.
17709141 2008 Elucidation of the substrate specificity of the MASP-2 protease of the lectin complement pathway and identification of the enzyme as a major physiological target of the serpin, C1-inhibitor.
17614162 2009 No association of TDP-43 with sporadic frontotemporal dementia.
17565323 2007 The influence of innate immunity gene receptors polymorphisms in renal transplant infections.
17303612 2007 Genetic polymorphisms of mannan binding lectin (MBL), serum levels of MBL, the MBL associated serine protease and H-ficolin in patients with Crohn's disease.
17252003 2007 Deficiency of mannan-binding lectin associated serine protease-2 due to missense polymorphisms.
17182967 2007 Cooperation between MASP-1 and MASP-2 in the generation of C3 convertase through the MBL pathway.
17096357 2007 Genetic influences on mannan-binding lectin (MBL) and mannan-binding lectin associated serine protease-2 (MASP-2) activity.
17045845 2006 The mannan-binding lectin pathway and lung disease in cystic fibrosis--disfunction of mannan-binding lectin-associated serine protease 2 (MASP-2) may be a major modifier.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16395704 2006 Clinical significance of mannose-binding lectin-associated serine protease-2 expression in esophageal squamous cell carcinoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16112196 2006 Extra-hepatic transcription of the human mannose-binding lectin gene (mbl2) and the MBL-associated serine protease 1-3 genes.
16040602 2005 A true autoactivating enzyme. Structural insight into mannose-binding lectin-associated serine protease-2 activations.
16029433 2005 Novel MASP2 variants detected among North African and Sub-Saharan individuals.
15746044 2005 Serum mannan-binding lectin-associated serine protease 2 levels in colorectal cancer: relation to recurrence and mortality.
15364579 2004 The structure of MBL-associated serine protease-2 reveals that identical substrate specificities of C1s and MASP-2 are realized through different sets of enzyme-substrate interactions.
15117939 2004 The X-ray structure of human mannan-binding lectin-associated protein 19 (MAp19) and its interaction site with mannan-binding lectin and L-ficolin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12904520 2003 Inherited deficiency of mannan-binding lectin-associated serine protease 2.
12538697 2003 Natural substrates and inhibitors of mannan-binding lectin-associated serine protease-1 and -2: a study on recombinant catalytic fragments.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421953 2002 Characterization of the interaction between L-ficolin/p35 and mannan-binding lectin-associated serine proteases-1 and -2.
11907111 2002 Activation of the lectin complement pathway by H-ficolin (Hakata antigen).
11532276 2001 The mannan-binding lectin pathway of complement activation: biology and disease association.
11426320 2001 The human gene for mannan-binding lectin-associated serine protease-2 (MASP-2), the effector component of the lectin route of complement activation, is part of a tightly linked gene cluster on chromosome 1p36.2-3.
10946292 2000 Proteolytic activities of two types of mannose-binding lectin-associated serine protease.
10925294 2000 Distinct pathways of mannan-binding lectin (MBL)- and C1-complex autoactivation revealed by reconstitution of MBL with recombinant MBL-associated serine protease-2.
10878362 2000 Interaction of C1q and mannan-binding lectin (MBL) with C1r, C1s, MBL-associated serine proteases 1 and 2, and the MBL-associated protein MAp19.
10679061 2000 Cutting edge: complement-activating complex of ficolin and mannose-binding lectin-associated serine protease.
10639434 2000 Mannose-binding lectin binds to a range of clinically relevant microorganisms and promotes complement deposition.
10393416 1999 Assignment of the gene encoding mannan-binding lectin-associated serine protease 2 (MASP2) to human chromosome 1p36.3-->p36.2 by in situ hybridization and somatic cell hybrid analysis.
10330290 1999 A truncated form of mannose-binding lectin-associated serine protease (MASP)-2 expressed by alternative polyadenylation is a component of the lectin complement pathway.
10092804 1999 Two constituents of the initiation complex of the mannan-binding lectin activation pathway of complement are encoded by a single structural gene.
9777418 1998 MASP-2, the C3 convertase generating protease of the MBLectin complement activating pathway.
9087411 1997 A second serine protease associated with mannan-binding lectin that activates complement.
8618346 1996 Towards a comprehensive database of proteins from the urine of patients with bladder cancer.
8018603 1994 Molecular characterization of a novel serine protease involved in activation of the complement system by mannose-binding protein.