Property Summary

NCBI Gene PubMed Count 77
PubMed Score 303.83
PubTator Score 165.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 2.500 1.2e-03
oligodendroglioma 2.300 3.7e-03
posterior fossa group B ependymoma 2.900 6.0e-12
glioblastoma 1.100 3.1e-02
pancreatic ductal adenocarcinoma liver m... -1.520 1.6e-02
X-linked cerebral adrenoleukodystrophy -2.300 6.2e-03
fibroadenoma 1.200 1.7e-03
adult high grade glioma 2.000 6.5e-05
group 3 medulloblastoma -1.300 1.2e-02
Breast cancer -1.400 4.0e-02
ulcerative colitis 1.300 2.8e-02

Gene RIF (58)

PMID Text
26645987 described for the first time a detailed model of prothrombin activation by MASP-1
26371246 The levels of MASP-1 and MASP-1/C1-INH complexes are reduced in HAE patients compared with controls. Both MASP-1 and MASP-1/C1-INH complexes are related to the degree of complement C4 consumption
26260032 Fusion of MAP-1 with FH domains represents a novel therapeutic approach for selective targeting upstream and central complement activation at sites of inflammation
25862418 Polymorphisms in MASP1 and MASP2 genes are associated with the susceptibility or protection to infectious diseases. (Review)
25745807 MASP-1 cleaves prothrombin and identified its cleavage sites, suggesting that MASP-1 gives rise to an alternative active form of thrombin by cleaving at the cleavage site R393.
25533914 Because MASP-1 and MASP-2 have been shown to interact directly with blood coagulation, elevated levels of these proteins may play a role in the enhanced thrombotic environment and consequent vascular complications in diabetes.
24683193 We found that rMAP-1 can engage in heterocomplexes with rMASP-1 and rMASP-3 in a calcium-dependent manner
24489848 MASP-1 may activate neutrophils indirectly via endothelial cells.
24472859 Data show that among the components of the mannose-binding lectin (MBL) and associated serine proteases (MASPs) only MASP-1 is able to trigger response in endothelial cells (HUVECs) and the proteolytic activity of MASP-1 is essential.
24424083 Data indicate that MASP-1 and MASP-2 can readily form heterodimers after dissociation and re-association, however, in the presence of Ca(2+) exchange of subunits is slow between the homodimers.
24023860 Polymorphisms in the MASP1 gene are associated with serum levels of MASP-1, MASP-3, and MAp44
23911397 Studies indicate that initiation of lectin compleme pathway leads to activation of the serine proteases MASP-1 and MASP-2 resulting in deposition of C4 on the activator and assembly of the C3 convertase.
23861840 The serine protease domain of MASP-3 exerts weak enzymatic activity.
23841802 accelerates fibrosis progression in hepatitis C virus-induced liver disease
23792966 insights into the function of MASP-3 reveal how a mutation in this enzyme causes it to be inactive and thus contribute to the 3MC syndrome.
23785123 In this study, we demonstrate that, although MASPs do not directly form heterodimers, the addition of mannan-binding lectin or ficolins allows the formation of MASP-1-MASP-2 co-complexes.
23402018 MASP-1 seems to be involved in activation of both the lectin and alternative complement pathways--{review}
23386610 autoactivation of MASP-1 is crucial for the activation of MBL/ficolin.MASP complexes, and in the proenzymic phase zymogen MASP-1 controls the process
23220946 collectin-11 associates with all the known MBL-associated serine proteases (MASP-1, MASP-2 and MASP-3) as well as the lectin complement pathway regulator MAP-1.
22966085 A crucial role of MASP-1 is demonstrated in the activation of MASP-2, as well as of MASP-3, based on a patient harboring a nonsense mutation in the common part of the MASP1 gene.
22854970 MAP-1 competes with all three MASPs for ligand binding and is able to mediate a strong dose-dependent inhibitory effect on the lectin pathway activation, as measured by levels of C3 and C9.
22691502 MASP-1 activates MASP-2 and, moreover, inhibition of MASP-1 prevents autoactivation of MASP-2
22670777 MASP-1 was present at adult level at 1 year of age, while it was 60% at birth. The present data prepare the ground for studies on the associations of MASP-1 levels with disease.
22607836 The interaction of mannan-binding lectin (MBL) with its associated serine proteases (MASPs) was investigated using recombinant (r) MBL, plasma-derived (pd) MBL, rMASP-3 and rMAp19. rMASP-3 and rMAp19 bound to free available sites on rMBL and pdMBL.
22536427 MASP-1, in concerted action with other complement and coagulation proteins, may play a role in fibrin clot formation.
22511776 Monospecific inhibitors show that both mannan-binding lectin-associated serine protease-1 (MASP-1) and -2 Are essential for lectin pathway activation and reveal structural plasticity of MASP-2.
21625439 showed that MASP-1 was able to cleave HK resulting in BK production. MASP-2 could also cleave HK but could not release BK. The cleavage pattern of MASPs is similar but not strictly identical to that of kallikrein
21258343 these findings demonstrate a role for complement pathway factors in fundamental developmental processes and in the etiology of 3MC syndrome.
21054788 MBL-associated serine protease 3 (MASP-3) also inhibited binding between MBL and CD91, suggesting that the site of interaction is located at or near the MASP-MBL interaction site.
21035106 These results implicate mutations of MASP1 as the cause of a human malformation syndrome and demonstrate the involvement of MASP1 in facial, umbilical, and ear development during the embryonic period.
20817870 MASP-1 has a crucial role in the initiation steps of lectin pathway activation most probably by activating MASP-2
20673767 The normal serum level of the second and third splice products of the MASP1 gene, MASP-3 and MAp44, have been established, as well as their ontogeny and acute phase response.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20053996 novel 45-kDa serum protein derived from the MASP1 gene, which is highly expressed in striated muscle tissues and is found in complex with MBL and ficolins and may function as a potent inhibitor of the complement system in vivo
19939495 MBL-associated serine protease-3 down-regulate Ficolin-3 mediated complement activation through the lectin pathway.
19917686 We present a novel, phylogenetically conserved protein, MAp44, which is found in human serum at 1.4 microg/ml in Ca(2+)-dependent complexes with the soluble pattern recognition molecules.
19917686 MAp44, a novel third splice product of the MASP1 gene, which associates with pattern-recognition molecules of the complement system and regulates the lectin pathway of complement activation.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19667088 MASP-1-induced protease-activated receptor (PAR)4 activation could contribute to the development of the inflammatory reaction.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19607727 EPHB3, MASP1 and SST map to 3q26.2-q29 and may have roles in squamous cell carcinoma of the lung
19564340 structure shows that its substrate binding groove is accessible; however, its reactivity could be modulated by an unusually large 60-loop and an internal salt bridge involving the S1 Asp.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18842294 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18596036 crystallographic analysis of the CUB1-EGF-CUB2 domain of human MASP-1/3 and identification of its interaction sites with mannan-binding lectin and ficolins
18456010 rMASP1 and thrombin cleave factor XIII A-chain and the fibrinogen beta-chain at identical sites, but differ in cleavage of the fibrinogen alpha-chain.
17938215 mannose-binding lectin (MBL)/MBL-associated serine protease (MASP) complexes and L-ficolin/MASP complexes bind to different strains of GBS to activate the lectin pathway
17444953 Observational study of gene-disease association. (HuGE Navigator)
17444953 MASP1 gene harbors a low-frequent polymorphic site resulting in an amino acid substitution, which may influence the function of the gene product.
16112196 The mRNA distribution of masp1 and masp2 were found very similar to that of mbl2, while masp3 mRNA seemed ubiquitous present at quite high levels when compared to liver.
16112196 The mRNA distribution of masp1 and masp2 were found very similar to that of mbl2, while masp3 mRNA seemed ubiquitous present at quite high levels when compared to liver. (masp3)
16102832 On average, high MASP-1 correlates with low MASP-2 and vice-versa, and confirms the hypothesis that native MBL-MASP complexes on average do not have fixed MBL-(MASP-1)-(MASP-2) stoichiometry.
12601245 detection of a processed pseudogene of this protein
12421953 The interaction of recombinant MASP1, its N-terminal complement modules, and MBL-associated protein 19 with L-ficolin/p35 has been characterized by surface plasmon resonance spectroscopy.
12370377 When incubated with the pathogenic organism Staphylococcus aureus, mannose-binding lectin-associated MASP enhances complement activation and opsonophagocytosis.

AA Sequence

MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESS      1 - 70
YLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDV     71 - 140
DECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSS    141 - 210
ECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFH    211 - 280
SDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECL    281 - 350
KDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVW    351 - 420
MNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAH    421 - 490
CLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLE    491 - 560
SPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMI    561 - 630
CAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN     631 - 699
//

Text Mined References (89)

PMID Year Title
26645987 2015 MASP-1 Induced Clotting--The First Model of Prothrombin Activation by MASP-1.
26419238 2015 Novel MASP1 mutations are associated with an expanded phenotype in 3MC1 syndrome.
26371246 2015 The Levels of the Lectin Pathway Serine Protease MASP-1 and Its Complex Formation with C1 Inhibitor Are Linked to the Severity of Hereditary Angioedema.
26260032 2015 Genetically engineered fusion of MAP-1 and factor H domains 1-5 generates a potent dual upstream inhibitor of both the lectin and alternative complement pathways.
25862418 2015 MBL-associated serine proteases (MASPs) and infectious diseases.
25745807 2015 MASP-1 of the complement system promotes clotting via prothrombin activation.
25533914 2015 Plasma levels of mannan-binding lectin-associated serine proteases MASP-1 and MASP-2 are elevated in type 1 diabetes and correlate with glycaemic control.
24683193 2014 Heterocomplex formation between MBL/ficolin/CL-11-associated serine protease-1 and -3 and MBL/ficolin/CL-11-associated protein-1.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24489848 2014 MASP-1 induces a unique cytokine pattern in endothelial cells: a novel link between complement system and neutrophil granulocytes.
24472859 2014 Serum MASP-1 in complex with MBL activates endothelial cells.
24424083 2014 Dissociation and re-association studies on the interaction domains of mannan-binding lectin (MBL)-associated serine proteases, MASP-1 and MASP-2, provide evidence for heterodimer formation.
24023860 2013 Polymorphisms in the MASP1 gene are associated with serum levels of MASP-1, MASP-3, and MAp44.
23911397 2013 Toward a structure-based comprehension of the lectin pathway of complement.
23861840 2013 The serine protease domain of MASP-3: enzymatic properties and crystal structure in complex with ecotin.
23841802 2013 Mannan binding lectin-associated serine protease 1 is induced by hepatitis C virus infection and activates human hepatic stellate cells.
23792966 2013 The x-ray crystal structure of mannose-binding lectin-associated serine proteinase-3 reveals the structural basis for enzyme inactivity associated with the Carnevale, Mingarelli, Malpuech, and Michels (3MC) syndrome.
23785123 2013 Co-complexes of MASP-1 and MASP-2 associated with the soluble pattern-recognition molecules drive lectin pathway activation in a manner inhibitable by MAp44.
23402018 2013 The role of MASP-1/3 in complement activation.
23386610 2013 Quantitative characterization of the activation steps of mannan-binding lectin (MBL)-associated serine proteases (MASPs) points to the central role of MASP-1 in the initiation of the complement lectin pathway.
23220946 2013 Collectin-11/MASP complex formation triggers activation of the lectin complement pathway--the fifth lectin pathway initiation complex.
22966085 2012 Mannan-binding lectin-associated serine protease (MASP)-1 is crucial for lectin pathway activation in human serum, whereas neither MASP-1 nor MASP-3 is required for alternative pathway function.
22854970 2012 Crystal structure and functional characterization of the complement regulator mannose-binding lectin (MBL)/ficolin-associated protein-1 (MAP-1).
22691502 2012 Revised mechanism of complement lectin-pathway activation revealing the role of serine protease MASP-1 as the exclusive activator of MASP-2.
22670777 2012 Mannan-binding lectin (MBL)-associated serine protease-1 (MASP-1), a serine protease associated with humoral pattern-recognition molecules: normal and acute-phase levels in serum and stoichiometry of lectin pathway components.
22607836 2012 MASP interactions with plasma-derived MBL.
22536427 2012 Effects of MASP-1 of the complement system on activation of coagulation factors and plasma clot formation.
22511776 2012 Monospecific inhibitors show that both mannan-binding lectin-associated serine protease-1 (MASP-1) and -2 Are essential for lectin pathway activation and reveal structural plasticity of MASP-2.
21625439 2011 Cleavage of kininogen and subsequent bradykinin release by the complement component: mannose-binding lectin-associated serine protease (MASP)-1.
21258343 2011 Mutations in lectin complement pathway genes COLEC11 and MASP1 cause 3MC syndrome.
21054788 2010 CD91 interacts with mannan-binding lectin (MBL) through the MBL-associated serine protease-binding site.
21035106 2010 MASP1 mutations in patients with facial, umbilical, coccygeal, and auditory findings of Carnevale, Malpuech, OSA, and Michels syndromes.
20817870 2010 Selective inhibition of the lectin pathway of complement with phage display selected peptides against mannose-binding lectin-associated serine protease (MASP)-1 and -2: significant contribution of MASP-1 to lectin pathway activation.
20673767 2010 Biological variations of MASP-3 and MAp44, two splice products of the MASP1 gene involved in regulation of the complement system.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20053996 2010 A novel mannose-binding lectin/ficolin-associated protein is highly expressed in heart and skeletal muscle tissues and inhibits complement activation.
19939495 2010 MBL-associated serine protease-3 circulates in high serum concentrations predominantly in complex with Ficolin-3 and regulates Ficolin-3 mediated complement activation.
19917686 2009 MAp44, a human protein associated with pattern recognition molecules of the complement system and regulating the lectin pathway of complement activation.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19667088 2009 Complement protease MASP-1 activates human endothelial cells: PAR4 activation is a link between complement and endothelial function.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19607727 2009 Identification of novel candidate target genes, including EPHB3, MASP1 and SST at 3q26.2-q29 in squamous cell carcinoma of the lung.
19564340 2009 MASP-1, a promiscuous complement protease: structure of its catalytic region reveals the basis of its broad specificity.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18596036 2008 Crystal structure of the CUB1-EGF-CUB2 domain of human MASP-1/3 and identification of its interaction sites with mannan-binding lectin and ficolins.
18456010 2008 The action of MBL-associated serine protease 1 (MASP1) on factor XIII and fibrinogen.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17938215 2008 L-Ficolin/mannose-binding lectin-associated serine protease complexes bind to group B streptococci primarily through N-acetylneuraminic acid of capsular polysaccharide and activate the complement pathway.
17444953 2007 A novel mannose-binding lectin-associated serine protease 1/3 gene variant.
17182967 2007 Cooperation between MASP-1 and MASP-2 in the generation of C3 convertase through the MBL pathway.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16554018 2006 Mannan-binding lectin-associated serine protease 3 cleaves synthetic peptides and insulin-like growth factor-binding protein 5.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16112196 2006 Extra-hepatic transcription of the human mannose-binding lectin gene (mbl2) and the MBL-associated serine protease 1-3 genes.
16102832 2006 Heterogeneity of MBL-MASP complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15034049 2004 Characterization of recombinant mannan-binding lectin-associated serine protease (MASP)-3 suggests an activation mechanism different from that of MASP-1 and MASP-2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12601245 2002 Detection of a processed pseudogene of the human MBL-associated serine protease, MASP1.
12538697 2003 Natural substrates and inhibitors of mannan-binding lectin-associated serine protease-1 and -2: a study on recombinant catalytic fragments.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421953 2002 Characterization of the interaction between L-ficolin/p35 and mannan-binding lectin-associated serine proteases-1 and -2.
12370377 2002 Enhancement of complement activation and opsonophagocytosis by complexes of mannose-binding lectin with mannose-binding lectin-associated serine protease after binding to Staphylococcus aureus.
11907111 2002 Activation of the lectin complement pathway by H-ficolin (Hakata antigen).
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11532276 2001 The mannan-binding lectin pathway of complement activation: biology and disease association.
11527969 2001 Substrate specificities of recombinant mannan-binding lectin-associated serine proteases-1 and -2.
11485744 2001 MASP-3 and its association with distinct complexes of the mannan-binding lectin complement activation pathway.
11290788 2001 Interaction properties of human mannan-binding lectin (MBL)-associated serine proteases-1 and -2, MBL-associated protein 19, and MBL.
10946292 2000 Proteolytic activities of two types of mannose-binding lectin-associated serine protease.
10925294 2000 Distinct pathways of mannan-binding lectin (MBL)- and C1-complex autoactivation revealed by reconstitution of MBL with recombinant MBL-associated serine protease-2.
10878362 2000 Interaction of C1q and mannan-binding lectin (MBL) with C1r, C1s, MBL-associated serine proteases 1 and 2, and the MBL-associated protein MAp19.
10679061 2000 Cutting edge: complement-activating complex of ficolin and mannose-binding lectin-associated serine protease.
10639434 2000 Mannose-binding lectin binds to a range of clinically relevant microorganisms and promotes complement deposition.
10475605 1999 Gene structure of the P100 serine-protease component of the human Ra-reactive factor.
9719152 1998 Glomerular deposition of mannose-binding lectin (MBL) indicates a novel mechanism of complement activation in IgA nephropathy.
9367419 1997 Human serum mannose-binding lectin (MBL)-associated serine protease-1 (MASP-1): determination of levels in body fluids and identification of two forms in serum.
9087411 1997 A second serine protease associated with mannan-binding lectin that activates complement.
8921412 1996 Exon structure of the gene encoding the human mannose-binding protein-associated serine protease light chain: comparison with complement C1r and C1s genes.
8240317 1993 A new member of the C1s family of complement proteins found in a bactericidal factor, Ra-reactive factor, in human serum.
8018603 1994 Molecular characterization of a novel serine protease involved in activation of the complement system by mannose-binding protein.
7759119 1995 Localization of the genes for the 100-kDa complement-activating components of Ra-reactive factor (CRARF and Crarf) to human 3q27-q28 and mouse 16B2-B3.