Property Summary

NCBI Gene PubMed Count 42
PubMed Score 96.91
PubTator Score 42.10

Knowledge Summary

Patent (2,712)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Thrombosis 41 0.0 0.0
Disease Target Count P-value
ovarian cancer 8297 2.3e-08
osteosarcoma 7766 6.0e-05
medulloblastoma, large-cell 6086 1.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2388 0.0 4.0

 IMPC Phenotype (1)

Gene RIF (22)

AA Sequence

MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFRMRRNPFTVYI      1 - 70
THLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGLYLLTAISVERCLSVLYPIWY     71 - 140
RCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAILSFLVFTPLMLVSSTIL    141 - 210
VVKIRKNTWASHSSKLYIVIMVTIIIFLIFAMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIY    211 - 280
FFVGSSKKKRFKESLKVVLTRAFKDEMQPRRQKDNCNTVTVETVV                             281 - 325
//

Text Mined References (43)

PMID Year Title