Property Summary

NCBI Gene PubMed Count 28
PubMed Score 52.74
PubTator Score 173.62

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (9)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651819 screening 1085 / 0 / 361502 High-Throughput Screening for Modulators of Cytosolic Chaperonin Activity

Gene RIF (19)

PMID Text
25666562 MARVELD2 variants are responsible for about 1.5 % (95 % CI 0.8-2.6) of non-syndromic hearing loss in our cohort of 800 Pakistani families. The c.1331+2T>C allele is recurrent.
25319490 The expressions of MARVELD2, CLDN1 and CLDN3 mRNA were significantly lower in cholesteatoma tissue and may be involved in epithelium permeability.
24652413 High tricellulin expression is associated with hepatocellular carcinoma.
23250572 This study reveals the presence and subcellular distribution of tricellulin in brain endothelial cells.
23239027 The findings show the heterogeneity of the molecular organization of tTJs in terms of the content of LSR, ILDR1 or ILDR2, and suggest that ILDR1-mediated recruitment of tricellulin to TCs is required for hearing.
23073616 The dynamic behavior of tricellulin during the destruction and formation of tight junctions (TJ) under various extracellular calcium conditions seems to be closely associated with the barrier and fence functions of TJs.
22394074 the tricellulin expression profile in normal and neoplastic human pancreas
22097895 DFNB49 is an important cause of non-syndromic deafness in Czech Roma patients but not in the general Czech population.
21868126 tricellulin and its role in tight junction formation and maintenance
21624353 the expression of tricellulin both in microglia and in the stomach immune cells point to a possible role of this new tight junctions protein in the immune system.
21480761 tricellulin is markedly reduced at all stages of tumor development. In situ hybridization analysis showed no correlation between HPV infection and altered expression of the tight junction proteins.
20533305 JNK may be involved in the regulation of tricellular tight junctions including TRIC expression and the barrier function in pancreatic duct epithelial cells.
20164257 marvelD3, occludin, and tricellulin define the tight junction-associated MARVEL protein family
20033365 These results suggest that tricellulin is stably expressed in human nasal epithelial cells and may play an important role for the sealing of the corner at tricellular contacts to prevent infiltration by various inhaled viruses and antigens.
19915590 TRiC does not physically block the polyQ tract of Htt itself, but rather sequesters a short Htt sequence element, N-terminal to the polyQ tract, that promotes the amyloidogenic conformation.
19538290 Differential phosphorylation of tricellulin by casein kinase 1 (CK1) and casein kinase 2
19535456 Data suggest that at low tricellulin expression the tricellular tight junction central tube forms a pathway, but at higher expression tricellulin forms a barrier for macromolecules in tricellular TJs and in bicellular TJs for solutes of all sizes.
18084694 Splice-site mutations in the TRIC gene underlie autosomal recessive nonsyndromic hearing impairment
15538632 Maps to 5q12.3-q14.1.

AA Sequence

MSNDGRSRNRDRRYDEVPSDLPYQDTTIRTHPTLHDSERAVSADPLPPPPLPLQPPFGPDFYSSDTEEPA      1 - 70
IAPDLKPVRRFVPDSWKNFFRGKKKDPEWDKPVSDIRYISDGVECSPPASPARPNHRSPLNSCKDPYGGS     71 - 140
EGTFSSRKEADAVFPRDPYGSLDRHTQTVRTYSEKVEEYNLRYSYMKSWAGLLRILGVVELLLGAGVFAC    141 - 210
VTAYIHKDSEWYNLFGYSQPYGMGGVGGLGSMYGGYYYTGPKTPFVLVVAGLAWITTIIILVLGMSMYYR    211 - 280
TILLDSNWWPLTEFGINVALFILYMAAAIVYVNDTNRGGLCYYPLFNTPVNAVFCRVEGGQIAAMIFLFV    281 - 350
TMIVYLISALVCLKLWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMK    351 - 420
PELLSGHIPPGHIPKPIVMPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVM    421 - 490
SRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDVQGYS      491 - 558
//

Text Mined References (31)

PMID Year Title
25666562 2015 Molecular genetics of MARVELD2 and clinical phenotype in Pakistani and Slovak families segregating DFNB49 hearing loss.
25319490 2015 Increased permeability of the epithelium of middle ear cholesteatoma.
24652413 2014 Tricellulin expression and its prognostic significance in primary liver carcinomas.
23250572 2013 Tricellulin expression in brain endothelial and neural cells.
23239027 2013 Analysis of the 'angulin' proteins LSR, ILDR1 and ILDR2--tricellulin recruitment, epithelial barrier function and implication in deafness pathogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23073616 2013 Behavior of tricellulin during destruction and formation of tight junctions under various extracellular calcium conditions.
22394074 2012 Tricellulin expression in normal and neoplastic human pancreas.
22097895 2012 DFNB49 is an important cause of non-syndromic deafness in Czech Roma patients but not in the general Czech population.
21868126 2011 A look at tricellulin and its role in tight junction formation and maintenance.
21624353 2011 Evidence of tricellulin expression by immune cells, particularly microglia.
21480761 2011 Altered expression of claudin-1, claudin-7, and tricellulin regardless of human papilloma virus infection in human tonsillar squamous cell carcinoma.
20533305 2010 c-Jun N-terminal kinase is largely involved in the regulation of tricellular tight junctions via tricellulin in human pancreatic duct epithelial cells.
20164257 2010 Tight junction-associated MARVEL proteins marveld3, tricellulin, and occludin have distinct but overlapping functions.
20033365 2009 Expression and localization of tricellulin in human nasal epithelial cells in vivo and in vitro.
19915590 2009 The chaperonin TRiC blocks a huntingtin sequence element that promotes the conformational switch to aggregation.
19538290 2009 Differential phosphorylation of occludin and tricellulin by CK2 and CK1.
19535456 2009 Tricellulin forms a barrier to macromolecules in tricellular tight junctions without affecting ion permeability.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18084694 2008 Splice-site mutations in the TRIC gene underlie autosomal recessive nonsyndromic hearing impairment in Pakistani families.
17186462 2006 Tricellulin is a tight-junction protein necessary for hearing.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16365161 2005 Tricellulin constitutes a novel barrier at tricellular contacts of epithelial cells.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15538632 2005 A new locus for nonsyndromic deafness DFNB49 maps to chromosome 5q12.3-q14.1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10409428 1999 Gene expression in proliferating human erythroid cells.