Property Summary

NCBI Gene PubMed Count 10
PubMed Score 25.29
PubTator Score 10.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Spastic Ataxia 18 3.977 2.0
Disease Target Count
spastic ataxia 3 1

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.600 1.6e-03

Gene RIF (4)

AA Sequence

MLRTSVLRLLGRTGASRLSLLEDFGPRYYSSGSLSAGDDACDVRAYFTTPIFYVNAAPHIGHLYSALLAD      1 - 70
ALCRHRRLRGPSTAATRFSTGTDEHGLKIQQAAATAGLAPTELCDRVSEQFQQLFQEAGISCTDFIRTTE     71 - 140
ARHRVAVQHFWGVLKSRGLLYKGVYEGWYCASDECFLPEAKVTQQPGPSGDSFPVSLESGHPVSWTKEEN    141 - 210
YIFRLSQFRKPLQRWLRGNPQAITPEPFHHVVLQWLDEELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWL    211 - 280
DALVNYLTVIGYPNAEFKSWWPATSHIIGKDILKFHAIYWPAFLLGAGMSPPQRICVHSHWTVCGQKMSK    281 - 350
SLGNVVDPRTCLNRYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLNSELADALGGLLNRCTAKRINPSET    351 - 420
YPAFCTTCFPSEPGLVGPSVRAQAEDYALVSAVATLPKQVADHYDNFRIYKALEAVSSCVRQTNGFVQRH    421 - 490
APWKLNWESPVDAPWLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLGVSASERSLGELYFLPRFYGH    491 - 560
PCPFEGRRLGPETGLLFPRLDQSRTWLVKAHRT                                         561 - 593
//

Text Mined References (12)

PMID Year Title