Property Summary

NCBI Gene PubMed Count 40
PubMed Score 48.13
PubTator Score 121.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
chronic lymphocytic leukemia 1.383 3.3e-03
Multiple myeloma 1.331 1.2e-03
malignant mesothelioma 1.500 9.0e-06
psoriasis -1.200 8.0e-04
osteosarcoma -2.249 4.4e-05
juvenile dermatomyositis 1.293 5.0e-11
lung cancer 1.600 3.6e-04
active Crohn's disease 1.060 2.3e-02
breast carcinoma 2.200 8.7e-04
Pick disease -1.100 4.7e-06
ovarian cancer 3.300 2.9e-07
dermatomyositis 1.600 2.7e-03

Protein-protein Interaction (3)

Gene RIF (14)

PMID Text
26472928 analysis of the heterotetrameric complex structure of the glutathione transferase (GST) domains shared among the four MSC components, methionyl-tRNA synthetase (MRS), glutaminyl-prolyl-tRNA synthetase (EPRS), AIMP2 and AIMP3
25913036 identification of a founder mutation in MARS led to the molecular definition of a specific type of pulmonary alveolar proteinosis and will enable carrier screening in the affected community and possibly open new treatment opportunities.
25010285 Interaction of HIV-1 Gag with methionyl-tRNA synthetase (MARS) is identified in a series of six affinity purification/mass spectrometry screens
24354524 the association of rare MARS variant with late-onset autosomal dominant Charcot-Marie-Tooth neuropathy
24103465 The F370L and I523T mutations did not affect the association of MARS with the multisynthetase complex.
23729695 Here we present data suggesting that MARS is a very rare novel cause of late-onset CMT2.
22190034 Interaction of HIV-1 Gag with methionyl-tRNA synthetase (MARS) is identified in a series of six affinity purification/mass spectrometry screens
22106287 Data show that aminoacyl-tRNA synthetase-interacting multifunctional protein-3 (AIMP3)/p18 is released from aminoacyl-tRNA synthetase-interacting multifunctional protein-3 (AIMP3) by UV irradiation-induced stress.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of methionyl-tRNA synthetase (MARS) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19064571 Observational study of gene-disease association. (HuGE Navigator)
19064003 The last 15 residues of the previously defined N-terminal extension of hcMetRS are part of the catalytic domain, whereas the first 252 residues constitute the N-terminal extended domain.

AA Sequence

MRLFVSDGVPGCLPVLAAAGRARGRAEVLISTVGPEDCVVPFLTRPKVPVLQLDSGNYLFSTSAICRYFF      1 - 70
LLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGSVRRALTHIDHSLSRQNCPFLAGET     71 - 140
ESLADIVLWGALYPLLQDPAYLPEELSALHSWFQTLSTQEPCQRAAETVLKQQGVLALRPYLQKQPQPSP    141 - 210
AEGRAVTNEPEEEELATLSEEEIAMAVTAWEKGLESLPPLRPQQNPVLPVAGERNVLITSALPYVNNVPH    211 - 280
LGNIIGCVLSADVFARYSRLRQWNTLYLCGTDEYGTATETKALEEGLTPQEICDKYHIIHADIYRWFNIS    281 - 350
FDIFGRTTTPQQTKITQDIFQQLLKRGFVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDK    351 - 420
CGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGL    421 - 490
KPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWWKNPEQVDLYQFMAKDNVPFH    491 - 560
SLVFPCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGVGVFGDMAQDTGIPADIWRFYLLYIRPEGQD    561 - 630
SAFSWTDLLLKNNSELLNNLGNFINRAGMFVSKFFGGYVPEMVLTPDDQRLLAHVTLELQHYHQLLEKVR    631 - 700
IRDALRSILTISRHGNQYIQVNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQ    701 - 770
LQLPPPACSILLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQ    771 - 840
QIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKKK              841 - 900
//

Text Mined References (47)

PMID Year Title
26472928 2015 Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains.
25913036 2015 Biallelic Mutations of Methionyl-tRNA Synthetase Cause a Specific Type of Pulmonary Alveolar Proteinosis Prevalent on Réunion Island.
24482476 2014 Exome sequencing links corticospinal motor neuron disease to common neurodegenerative disorders.
24354524 2014 Rare variants in methionyl- and tyrosyl-tRNA synthetase genes in late-onset autosomal dominant Charcot-Marie-Tooth neuropathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24103465 2013 Rare recessive loss-of-function methionyl-tRNA synthetase mutations presenting as a multi-organ phenotype.
23729695 2013 Exome sequencing identifies a significant variant in methionyl-tRNA synthetase (MARS) in a family with late-onset CMT2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22106287 2011 Dual role of methionyl-tRNA synthetase in the regulation of translation and tumor suppressor activity of aminoacyl-tRNA synthetase-interacting multifunctional protein-3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
19064003 2009 Two non-redundant fragments in the N-terminal peptide of human cytosolic methionyl-tRNA synthetase were indispensable for the multi-synthetase complex incorporation and enzyme activity.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16055448 2005 The C-terminal appended domain of human cytosolic leucyl-tRNA synthetase is indispensable in its interaction with arginyl-tRNA synthetase in the multi-tRNA synthetase complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12729910 2003 Solution structure and p43 binding of the p38 leucine zipper motif: coiled-coil interactions mediate the association between p38 and p43.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11732605 2001 Methionyl-tRNA synthetase.
11714285 2001 The appended C-domain of human methionyl-tRNA synthetase has a tRNA-sequestering function.
10913161 2000 Heat shock protein 90 mediates protein-protein interactions between human aminoacyl-tRNA synthetases.
10791971 2000 Nucleolar localization of human methionyl-tRNA synthetase and its role in ribosomal RNA synthesis.
10448063 1999 CHOP/GADD153 and methionyl-tRNA synthetase (MetRS) genes overlap in a conserved region that controls mRNA stability.
10200289 1999 Genetic dissection of protein-protein interactions in multi-tRNA synthetase complex.
9878398 1999 Macromolecular assemblage of aminoacyl-tRNA synthetases: identification of protein-protein interactions and characterization of a core protein.
9278442 1997 Human lysyl-tRNA synthetase accepts nucleotide 73 variants and rescues Escherichia coli double-defective mutant.
8921912 1996 Cloning of a human cDNA encoding a protein with high homology to yeast methionyl-tRNA synthetase.
8449960 1993 Expression of human aspartyl-tRNA synthetase in Escherichia coli. Functional analysis of the N-terminal putative amphiphilic helix.
8188258 1994 The human EPRS locus (formerly the QARS locus): a gene encoding a class I and a class II aminoacyl-tRNA synthetase.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8078941 1994 Evolution of the Glx-tRNA synthetase family: the glutaminyl enzyme as a case of horizontal gene transfer.
8052601 1994 Human cytoplasmic isoleucyl-tRNA synthetase: selective divergence of the anticodon-binding domain and acquisition of a new structural unit.
6585969 1984 Assignment of the human MARS gene, encoding methioninyl-tRNA synthetase, to chromosome 12 using human X Chinese hamster cell hybrids.