Property Summary

NCBI Gene PubMed Count 28
PubMed Score 37.94
PubTator Score 28.63

Knowledge Summary

Patent (2,698)

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.3e-07
adult high grade glioma 2148 6.3e-06
medulloblastoma, large-cell 6234 1.3e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.100 1.3e-03
adult high grade glioma -1.400 6.3e-06
ovarian cancer 1.500 1.3e-07

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (15)

PMID Text
26346160 Atypical PKC phosphorylates serine-threonine residues of MARK4.
25578778 Suggest role for polypyrimidine-tract binding protein in regulating alternative splicing of MARK4 in gliomas.
25123532 MARK4 is a key component in the regulation of microtubule dynamics and has major role in cell cycle progression, particularly at the G1/S transition.
24763618 Molecular dynamic simulation data predicted the three dimensional structure for the kinase domain of MARK4 and its structural properties.
23666762 A strong and significant elevation of MARK4 expression and MARK4-tau interactions in AD brains correlates with the Braak stages of the disease, suggesting that the MARK4-tau interactions are of functional importance in the progression of AD.
23400999 MARK4 is a critical positive regulator of early steps in ciliogenesis.
23184942 MARK4 is a new negative regulator of mTORC1
22506312 Even though an association of the polymorphisms rs2850328 and rs2395 and breast cancer was not detected in our case-control study population, other variants within the PPP3CA and MARK4 genes may still be associated with breast cancer.
22156016 The balance between the MARK4 isoforms is carefully guarded during neural differentiation but may be subverted in gliomagenesis.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20460622 Observational study, meta-analysis, and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19759416 demonstrated that the endogenous MARK4L colocalizes with centrosomes at all mitotic stages and resides in centrosome-enriched fractions.
18254724 NUAK1 and MARK4 are substrates of USP9X
14594945 MARK4 is likely to be directly involved in microtubule organization in neuronal cells
12735302 Normally expressed in neural progenitors, re-expressed in gliomas and may become a target of amplification upon chr. 19 rearrangement.

AA Sequence

MSSRTVLAPGNDRNSDTHGTLGSGRSSDKGPSWSSRSLGARCRNSIASCPEEQPHVGNYRLLRTIGKGNF      1 - 70
AKVKLARHILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVKLFEVIETEKTLYLVMEYASA     71 - 140
GEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLLLDAEANIKIADFGFSNEFTLGS    141 - 210
KLDTFCGSPPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMS    211 - 280
TDCESILRRFLVLNPAKRCTLEQIMKDKWINIGYEGEELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKE    281 - 350
SLTSQKYNEVTATYLLLGRKTEEGGDRGAPGLALARVRAPSDTTNGTSSSKGTSHSKGQRSSSSTYHRQR    351 - 420
RHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSRGLPPSSPMVSSAHNPNKAEIPER    421 - 490
RKDSTSTPNNLPPSMMTRRNTYVCTERPGAERPSLLPNGKENSSGTPRVPPASPSSHSLAPPSGERSRLA    491 - 560
RGSTIRSTFHGGQVRDRRAGGGGGGGVQNGPPASPTLAHEAAPLPAGRPRPTTNLFTKLTSKLTRRVADE    561 - 630
PERIGGPEVTSCHLPWDQTETAPRLLRFPWSVKLTSSRPPEALMAALRQATAAARCRCRQPQPFLLACLH    631 - 700
GGAGGPEPLSHFEVEVCQLPRPGLRGVLFRRVAGTALAFRTLVTRISNDLEL                      701 - 752
//

Text Mined References (32)

PMID Year Title
26346160 2015 Atypical PKC phosphorylates microtubule affinity-regulating kinase 4 in vitro.
25578778 2015 Suggestive evidence on the involvement of polypyrimidine-tract binding protein in regulating alternative splicing of MAP/microtubule affinity-regulating kinase 4 in glioma.
25123532 Microtubule-associated protein/microtubule affinity-regulating kinase 4 (MARK4) plays a role in cell cycle progression and cytoskeletal dynamics.
24763618 2014 The structural analysis of MARK4 and the exploration of specific inhibitors for the MARK family: a computational approach to obstruct the role of MARK4 in prostate cancer progression.
23666762 2013 Role of individual MARK isoforms in phosphorylation of tau at Ser²?² in Alzheimer's disease.
23400999 2013 The microtubule affinity regulating kinase MARK4 promotes axoneme extension during early ciliogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184942 2013 Microtubule-associated protein/microtubule affinity-regulating kinase 4 (MARK4) is a negative regulator of the mammalian target of rapamycin complex 1 (mTORC1).
22506312 2011 Investigation of two Wnt signalling pathway single nucleotide polymorphisms in a breast cancer-affected Australian population.
22156016 2011 Differential signature of the centrosomal MARK4 isoforms in glioma.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20460622 2010 Genome-wide analysis of genetic loci associated with Alzheimer disease.
19759416 2009 Multiple localization of endogenous MARK4L protein in human glioma.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19245655 2009 The regulation and function of mammalian AMPK-related kinases.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
18254724 2008 Control of AMPK-related kinases by USP9X and atypical Lys(29)/Lys(33)-linked polyubiquitin chains.
17924967 2007 Genetic defects underlying Peutz-Jeghers syndrome (PJS) and exclusion of the polarity-associated MARK/Par1 gene family as potential PJS candidates.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
16959763 2006 Transgenic mouse proteomics identifies new 14-3-3-associated proteins involved in cytoskeletal rearrangements and cell signaling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15009667 2004 Identification of regulated genes during permanent focal cerebral ischaemia: characterization of the protein kinase 9b5/MARKL1/MARK4.
14976552 2004 LKB1 is a master kinase that activates 13 kinases of the AMPK subfamily, including MARK/PAR-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
14594945 2004 MARK4 is a novel microtubule-associated proteins/microtubule affinity-regulating kinase that binds to the cellular microtubule network and to centrosomes.
12735302 2003 The neural progenitor-restricted isoform of the MARK4 gene in 19q13.2 is upregulated in human gliomas and overexpressed in a subset of glioblastoma cell lines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
11326310 Isolation of a novel human gene, MARKL1, homologous to MARK3 and its involvement in hepatocellular carcinogenesis.
9108484 1997 MARK, a novel family of protein kinases that phosphorylate microtubule-associated proteins and trigger microtubule disruption.