Property Summary

Ligand Count 10
NCBI Gene PubMed Count 42
PubMed Score 289.64
PubTator Score 230.03

Knowledge Summary

Patent (4,384)

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.100 7.0e-06
osteosarcoma -1.258 1.4e-04
ovarian cancer -1.600 3.2e-07
psoriasis 1.400 1.6e-04

Protein-protein Interaction (1)

Gene RIF (14)

AA Sequence

MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKV      1 - 70
KLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEV     71 - 140
FDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLD    141 - 210
TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDC    211 - 280
ENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLS    281 - 350
KMKYDEITATYLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVFSSQKQRRYSD    351 - 420
HAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSS    421 - 490
TVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAATPDRIRFPRGTA    491 - 560
SRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRRNMSFRFIKRLPTEYE    561 - 630
RNGRYEGSSRNVSAEQKDENKEAKPRSLRFTWSMKTTSSMDPGDMMREIRKVLDANNCDYEQRERFLLFC    631 - 700
VHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL                     701 - 753
//

Text Mined References (55)

PMID Year Title