Property Summary

NCBI Gene PubMed Count 41
PubMed Score 277.62
PubTator Score 230.03

Knowledge Summary

Patent (4,384)

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 2.0e-06
malignant mesothelioma 3163 7.0e-06
osteosarcoma 7933 1.4e-04
psoriasis 6685 1.6e-04
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 2.0
Disease Target Count Z-score Confidence
Arthritis 248 3.222 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.100 7.0e-06
psoriasis 1.400 1.6e-04
osteosarcoma -1.258 1.4e-04
ovarian cancer -1.700 2.0e-06

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (14)

PMID Text
25028520 findings indicate that brain PP-1I associates with and is regulated by the associated protein kinases C-TAK1 and PFTK1
23894155 We have shown that serum ALP levels modified the association of MARK3 with bone mineral density in osetoporosis for Chinese patients.
20554715 Observational study of gene-disease association. (HuGE Navigator)
20534768 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20214879 interaction between Mitf and C-TAK1 was demonstrated.
19079262 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17726107 identify a molecular mechanism through which the hMARK3 UBA domain has evolved to bind the kinase domain
17672918 occurrence of an unusual TG 3' splice site in intron 3
16980613 Class IIa histone deacetylases (HDACs) are subjected to signal-independent nuclear export that relies on their constitutive phosphorylation. EMK and C-TAK1, are identified as regulators of this process.
16968750 14-3-3 binding to MARK3 is dependent on phosphorylation.
15319445 Data show that the protein kinase Cdc25 C-associated kinase 1 (C-TAK1) is a binding partner and a substrate of Pim-1, and suggest a role for Pim-1 as a positive regulator at the G(2)/M transition of the cell cycle.
15182702 The C-TAK1/p78 constitutively associates with and phosphorylates KSR1 generating a 14-3-3 binding site.
12941695 identify sequence motifs required for stable C-TAK1 association and substrate phosphorylation
12879020 results show that LKB1 can direct the phosphorylation of the serine-threonine kinase PAR1A

AA Sequence

MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKV      1 - 70
KLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEV     71 - 140
FDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLD    141 - 210
TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDC    211 - 280
ENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLS    281 - 350
KMKYDEITATYLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVFSSQKQRRYSD    351 - 420
HAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSS    421 - 490
TVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAATPDRIRFPRGTA    491 - 560
SRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRRNMSFRFIKRLPTEYE    561 - 630
RNGRYEGSSRNVSAEQKDENKEAKPRSLRFTWSMKTTSSMDPGDMMREIRKVLDANNCDYEQRERFLLFC    631 - 700
VHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL                     701 - 753
//

Text Mined References (54)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25028520 2014 Regulation of protein phosphatase 1I by Cdc25C-associated kinase 1 (C-TAK1) and PFTAIRE protein kinase.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23894155 2013 Genetic analysis of recently identified osteoporosis susceptibility genes in southern Chinese.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21145462 2010 Kinase associated-1 domains drive MARK/PAR1 kinases to membrane targets by binding acidic phospholipids.
20554715 2010 Analysis of recently identified osteoporosis susceptibility genes in Han Chinese women.
20534768 2010 OPG and RANK polymorphisms are both associated with cortical bone mineral density: findings from a metaanalysis of the Avon longitudinal study of parents and children and gothenburg osteoporosis and obesity determinants cohorts.
20214879 2010 C-TAK1 interacts with microphthalmia-associated transcription factor, Mitf, but not the related family member Tfe3.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19079262 2009 New sequence variants associated with bone mineral density.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17979178 2007 A novel tandem affinity purification strategy for the efficient isolation and characterisation of native protein complexes.
17726107 2007 Conformational instability of the MARK3 UBA domain compromises ubiquitin recognition and promotes interaction with the adjacent kinase domain.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
16980613 2006 New role for hPar-1 kinases EMK and C-TAK1 in regulating localization and activity of class IIa histone deacetylases.
16968750 2006 Regulation of the polarity kinases PAR-1/MARK by 14-3-3 interaction and phosphorylation.
16959763 2006 Transgenic mouse proteomics identifies new 14-3-3-associated proteins involved in cytoskeletal rearrangements and cell signaling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16306228 2005 14-3-3 cooperates with LKB1 to regulate the activity and localization of QSK and SIK.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15778465 2005 Targeted proteomic analysis of 14-3-3 sigma, a p53 effector commonly silenced in cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15319445 2004 The oncogenic serine/threonine kinase Pim-1 phosphorylates and inhibits the activity of Cdc25C-associated kinase 1 (C-TAK1): a novel role for Pim-1 at the G2/M cell cycle checkpoint.
15182702 2004 An overview of the KIN1/PAR-1/MARK kinase family.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15084291 2004 Atypical PKC phosphorylates PAR-1 kinases to regulate localization and activity.
14976552 2004 LKB1 is a master kinase that activates 13 kinases of the AMPK subfamily, including MARK/PAR-1.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
14594945 2004 MARK4 is a novel microtubule-associated proteins/microtubule affinity-regulating kinase that binds to the cellular microtubule network and to centrosomes.
12941695 2003 Functional analysis of C-TAK1 substrate binding and identification of PKP2 as a new C-TAK1 substrate.
12879020 2003 Regulation of the Wnt signalling component PAR1A by the Peutz-Jeghers syndrome kinase LKB1.
12556533 2003 Regulation of the interleukin-1-induced signaling pathways by a novel member of the protein phosphatase 2C family (PP2Cepsilon).
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11433294 2001 PAR-1 is a Dishevelled-associated kinase and a positive regulator of Wnt signalling.
9543386 1998 C-TAK1 protein kinase phosphorylates human Cdc25C on serine 216 and promotes 14-3-3 protein binding.
9533022 1997 Assignment of MARK3 alias KP78 to human chromosome band 14q32.3 by in situ hybridization.
8816492 1996 Direct interaction between protein kinase C theta (PKC theta) and 14-3-3 tau in T cells: 14-3-3 overexpression results in inhibition of PKC theta translocation and function.