Property Summary

NCBI Gene PubMed Count 33
PubMed Score 54.74
PubTator Score 844.23

Knowledge Summary

Patent (3,082)

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.200 2.1e-06
ependymoma -1.700 2.6e-06
non-small cell lung cancer 1.778 3.3e-13
lung cancer 1.400 1.2e-04
breast carcinoma -1.400 1.8e-05
fibroadenoma -1.400 1.2e-02
interstitial cystitis -1.600 1.4e-03
sonic hedgehog group medulloblastoma -1.400 3.2e-02
nasopharyngeal carcinoma 1.500 6.8e-03
lung carcinoma 2.400 2.8e-31

Gene RIF (9)

PMID Text
24362629 LKB1 acts through its substrates of the microtubule affinity-regulating kinase family to regulate the localization of the polarity determinant Scribble and the activity of the core Hippo kinases
24243102 the positioning of MARK/Par-1 at the crosstalk of regulating cytoskeletal dynamics allows its participation in neuronal polarity decisions. [review]
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20158304 In the Australian GWAS, the SNP rs7530302 near MARK1 on chromosome 1 (p=1.90 x 10(-9) achieved genomewide significance for comorbid AD/ND.
19090997 Data show that protein kinases of the MARK family phosphorylate tau protein in its repeat domain and thereby regulate its affinity for microtubules and affect the aggregation of tau into Alzheimer paired helical filaments.
18976975 Knockdown of MAP/microtubule affinity-regulating kinase 1 (MARK1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18492799 MARK1 was overexpressed in a prefrontal region in the brains of patients with Autism spectrum disorders.
18492799 Observational study of gene-disease association. (HuGE Navigator)
16803889 analysis of variations in the catalytic and ubiquitin-associated domains of microtubule-associated protein/microtubule affinity regulating kinase (MARK) 1 and MARK2

AA Sequence

MSARTPLPTVNERDTENHTSVDGYTEPHIQPTKSSSRQNIPRCRNSITSATDEQPHIGNYRLQKTIGKGN      1 - 70
FAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYAS     71 - 140
GGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVG    141 - 210
NKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYM    211 - 280
STDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEIN    281 - 350
DALINQKYDEVMATYILLGRKPPEFEGGESLSSGNLCQRSRPSSDLNNSTLQSPAHLKVQRSISANQKQR    351 - 420
RFSDHAGPSIPPAVSYTKRPQANSVESEQKEEWDKDVARKLGSTTVGSKSEMTASPLVGPERKKSSTIPS    421 - 490
NNVYSGGSMARRNTYVCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQKSMSTSGH    491 - 560
PIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHGEQLRERRSVAYNGP    561 - 630
PASPSHETGAFAHARRGTSTGIISKITSKFVRRDPSEGEASGRTDTSRSTSGEPKERDKEEGKDSKPRSL    631 - 700
RFTWSMKTTSSMDPNDMMREIRKVLDANNCDYEQKERFLLFCVHGDARQDSLVQWEMEVCKLPRLSLNGV    701 - 770
RFKRISGTSIAFKNIASKIANELKL                                                 771 - 795
//

Text Mined References (46)

PMID Year Title
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24362629 2014 A genetic screen identifies an LKB1-MARK signalling axis controlling the Hippo-YAP pathway.
24243102 2014 Mark/Par-1 marking the polarity of migrating neurons.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22205951 2011 Genome-wide association study in bipolar patients stratified by co-morbidity.
21897333 2011 Genes linked to energy metabolism and immunoregulatory mechanisms are associated with subcutaneous adipose tissue distribution in HIV-infected men.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21145462 2010 Kinase associated-1 domains drive MARK/PAR1 kinases to membrane targets by binding acidic phospholipids.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20158304 2010 A genomewide association study of nicotine and alcohol dependence in Australian and Dutch populations.
20071654 2010 Structure and function of polarity-inducing kinase family MARK/Par-1 within the branch of AMPK/Snf1-related kinases.
19559622 2009 The tau of MARK: a polarized view of the cytoskeleton.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19090997 2008 Structure and regulation of MARK, a kinase involved in abnormal phosphorylation of Tau protein.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18492799 2008 Convergent evidence identifying MAP/microtubule affinity-regulating kinase 1 (MARK1) as a susceptibility gene for autism.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17573348 2007 Suppression of tubulin polymerization by the LKB1-microtubule-associated protein/microtubule affinity-regulating kinase signaling.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
16803889 2006 Structural variations in the catalytic and ubiquitin-associated domains of microtubule-associated protein/microtubule affinity regulating kinase (MARK) 1 and MARK2.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14976552 2004 LKB1 is a master kinase that activates 13 kinases of the AMPK subfamily, including MARK/PAR-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14594945 2004 MARK4 is a novel microtubule-associated proteins/microtubule affinity-regulating kinase that binds to the cellular microtubule network and to centrosomes.
14517247 2003 MARKK, a Ste20-like kinase, activates the polarity-inducing kinase MARK/PAR-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435421 2002 Aberrant glycosylation modulates phosphorylation of tau by protein kinase A and dephosphorylation of tau by protein phosphatase 2A and 5.
12387894 2002 Involvement of aberrant glycosylation in phosphorylation of tau by cdk5 and GSK-3beta.
11433294 2001 PAR-1 is a Dishevelled-associated kinase and a positive regulator of Wnt signalling.
11089574 2000 Microtubule-affinity regulating kinase (MARK) is tightly associated with neurofibrillary tangles in Alzheimer brain: a fluorescence resonance energy transfer study.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10737616 2000 Phosphorylation sites on tau identified by nanoelectrospray mass spectrometry: differences in vitro between the mitogen-activated protein kinases ERK2, c-Jun N-terminal kinase and P38, and glycogen synthase kinase-3beta.
10090741 1999 Phosphorylation that detaches tau protein from microtubules (Ser262, Ser214) also protects it against aggregation into Alzheimer paired helical filaments.
9832145 1998 New phosphorylation sites identified in hyperphosphorylated tau (paired helical filament-tau) from Alzheimer's disease brain using nanoelectrospray mass spectrometry.
9771888 1998 Tau is phosphorylated by GSK-3 at several sites found in Alzheimer disease and its biological activity markedly inhibited only after it is prephosphorylated by A-kinase.
9735171 1998 Phosphorylation of tau at both Thr 231 and Ser 262 is required for maximal inhibition of its binding to microtubules.
9108484 1997 MARK, a novel family of protein kinases that phosphorylate microtubule-associated proteins and trigger microtubule disruption.
8999860 1997 The regulatory Ser262 of microtubule-associated protein tau is phosphorylated by phosphorylase kinase.
8631898 1996 Phosphorylation of microtubule-associated proteins MAP2 and MAP4 by the protein kinase p110mark. Phosphorylation sites and regulation of microtubule dynamics.
7931292 1994 Protein kinase FA/glycogen synthase kinase-3 alpha after heparin potentiation phosphorylates tau on sites abnormally phosphorylated in Alzheimer's disease brain.
7706316 1995 Microtubule-associated protein/microtubule affinity-regulating kinase (p110mark). A novel protein kinase that regulates tau-microtubule interactions and dynamic instability by phosphorylation at the Alzheimer-specific site serine 262.