Property Summary

NCBI Gene PubMed Count 40
PubMed Score 210.29
PubTator Score 162.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
tuberculosis 1.500 1.5e-04
adrenocortical carcinoma -1.260 1.3e-05
aldosterone-producing adenoma -1.216 3.4e-02
breast carcinoma -1.200 4.0e-02
colon cancer -1.100 1.3e-05
ductal carcinoma in situ -1.900 9.1e-03
fibroadenoma -2.100 4.3e-02
invasive ductal carcinoma -2.300 1.5e-02
lung adenocarcinoma -1.200 1.8e-09
lung cancer -2.200 1.0e-04
lung carcinoma -1.800 2.2e-14
non-small cell lung cancer -3.380 8.2e-23
ovarian cancer -4.600 5.7e-11
pancreatic cancer 1.100 4.3e-03
pancreatic ductal adenocarcinoma liver m... -1.998 1.1e-03
psoriasis 1.700 4.8e-05

Gene RIF (31)

AA Sequence

MRNKKILKEDELLSETQQAAFHQIAMEPFEINVPKPKRRNGVNFSLAVVVIYLILLTAGAGLLVVQVLNL      1 - 70
QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRVSHEHLLQRVDNFTQN     71 - 140
PGMFRIKGEQGAPGLQGHKGAMGMPGAPGPPGPPAEKGAKGAMGRDGATGPSGPQGPPGVKGEAGLQGPQ    141 - 210
GAPGKQGATGTPGPQGEKGSKGDGGLIGPKGETGTKGEKGDLGLPGSKGDRGMKGDAGVMGPPGAQGSKG    211 - 280
DFGRPGPPGLAGFPGAKGDQGQPGLQGVPGPPGAVGHPGAKGEPGSAGSPGRAGLPGSPGSPGATGLKGS    281 - 350
KGDTGLQGQQGRKGESGVPGPAGVKGEQGSPGLAGPKGAPGQAGQKGDQGVKGSSGEQGVKGEKGERGEN    351 - 420
SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRG    421 - 490
TESTLWSCTKNSWGHHDCSHEEDAGVECSV                                            491 - 520
//

Text Mined References (45)

PMID Year Title