Property Summary

NCBI Gene PubMed Count 26
PubMed Score 45.80
PubTator Score 76.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.013 4.0e-02
Barrett's esophagus 2.500 1.4e-02
esophageal adenocarcinoma 3.000 1.8e-02
cutaneous lupus erythematosus 1.400 1.3e-03
osteosarcoma 1.434 1.6e-02
medulloblastoma 1.200 6.8e-06
primitive neuroectodermal tumor 1.100 1.9e-04
tuberculosis -1.600 1.1e-05
primary pancreatic ductal adenocarcinoma 1.346 9.3e-03
non-small cell lung cancer 1.156 1.3e-12
intraductal papillary-mucinous adenoma (... 1.900 4.9e-04
intraductal papillary-mucinous carcinoma... 1.900 1.8e-03
intraductal papillary-mucinous neoplasm ... 1.900 9.7e-03
Hydrolethalus syndrome -1.064 2.8e-02
lung cancer 3.000 1.2e-05
colon cancer 1.600 6.1e-07
pancreatic cancer 1.700 1.2e-07
breast carcinoma 1.100 1.1e-02
fibroadenoma 1.500 2.9e-02
Multiple Sclerosis 1.200 2.1e-04
Breast cancer 2.400 3.6e-02
subependymal giant cell astrocytoma -3.556 1.2e-02
lung adenocarcinoma 1.616 4.9e-05
ductal carcinoma in situ 2.700 2.2e-04
invasive ductal carcinoma 3.000 1.3e-03
ovarian cancer 1.900 1.4e-04
Gaucher disease type 1 1.300 4.6e-02

Gene RIF (4)

PMID Text
26555156 MARCKSL1 showed potent anti-angiogenic activity and reduced the levels of VEGF and HIF-1alpha expression. MARCKSL1 decreased VEGFinduced phosphorylation of the PI3K/Akt signaling pathway components.
24863880 MARCKSL1 suppresses LOXL2-induced oncogenesis.
22772381 Patients with high expression of PPH3 and high MARCKSL1 protein had a lower survival rate versus patients with low MARCKSL1 and high PPH3 expression.
22751924 Gene knockdown in prostate cancer cells or in neurons reveals a critical role for MARCKSL1 in migration that is dependent on the phosphorylation state.

AA Sequence

MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPP      1 - 70
SQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTA     71 - 140
QEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE                   141 - 195
//

Text Mined References (37)

PMID Year Title
26555156 2016 MARCKSL1 exhibits anti-angiogenic effects through suppression of VEGFR-2-dependent Akt/PDK-1/mTOR phosphorylation.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24863880 2014 Lysyl oxidase-like 2 (LOXL2) controls tumor-associated cell proliferation through the interaction with MARCKSL1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22772381 2012 The prognostic value of MARCKS-like 1 in lymph node-negative breast cancer.
22751924 2012 c-Jun N-terminal kinase phosphorylation of MARCKSL1 determines actin stability and migration in neurons and in cancer cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19924305 2009 A cell motility screen reveals role for MARCKS-related protein in adherens junction formation and tumorigenesis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19246034 2009 Suppression of the lipopolysaccharide-induced expression of MARCKS-related protein (MRP) affects transmigration in activated RAW264.7 cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17897642 2008 Investigation into the mechanism regulating MRP localization.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17292354 2007 The regulation of MacMARCKS expression by integrin beta3.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16429158 2006 Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10827182 2000 Protein kinase C-regulated dynamitin-macrophage-enriched myristoylated alanine-rice C kinase substrate interaction is involved in macrophage cell spreading.
9598313 1998 Promoter sequence, expression, and fine chromosomal mapping of the human gene (MLP) encoding the MARCKS-like protein: identification of neighboring and linked polymorphic loci for MLP and MACS and use in the evaluation of human neural tube defects.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8132675 1994 Protein kinase C-mediated phosphorylation and calmodulin binding of recombinant myristoylated alanine-rich C kinase substrate (MARCKS) and MARCKS-related protein.
1864362 1991 A mouse brain cDNA encodes a novel protein with the protein kinase C phosphorylation site domain common to MARCKS.