Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.08
PubTator Score 127.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
adult high grade glioma 2148 5.5e-03
group 3 medulloblastoma 2254 1.1e-02

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma 1.600 5.5e-03
group 3 medulloblastoma 1.100 1.1e-02

 GO Process (1)

Protein-protein Interaction (2)

Gene RIF (4)

PMID Text
20870941 Downregulation of Mult1 by MARCH9 was reversed by heat-shock treatment, which resulted in the dissociation of the two proteins and increased the amount of Mult1 at the cell surface.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17174307 MARCH-IX expression causes ubiquitination and downregulation of ICAM-1

AA Sequence

MLKSRLRMFLNELKLLVLTGGGRPRAEPQPRGGRGGGCGWAPFAGCSTRDGDGDEEEYYGSEPRARGLAG      1 - 70
DKEPRAGPLPPPAPPLPPPGALDALSLSSSLDSGLRTPQCRICFQGPEQGELLSPCRCDGSVRCTHQPCL     71 - 140
IRWISERGSWSCELCYFKYQVLAISTKNPLQWQAISLTVIEKVQIAAIVLGSLFLVASISWLIWSSLSPS    141 - 210
AKWQRQDLLFQICYGMYGFMDVVCIGLIIHEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAG    211 - 280
KSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV        281 - 346
//

Text Mined References (8)

PMID Year Title
20870941 2010 Stress-regulated targeting of the NKG2D ligand Mult1 by a membrane-associated RING-CH family E3 ligase.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17174307 2007 MARCH-IX mediates ubiquitination and downregulation of ICAM-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14722266 2004 Downregulation of major histocompatibility complex class I by human ubiquitin ligases related to viral immune evasion proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.