Property Summary

NCBI Gene PubMed Count 24
PubMed Score 40.26
PubTator Score 8.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -3.753 6.2e-05
astrocytoma 1.700 7.1e-03
Breast cancer -1.200 2.4e-06
mucosa-associated lymphoid tissue lympho... 1.127 1.2e-02
ovarian cancer -2.200 1.4e-09
dermatomyositis 1.400 6.1e-04

Gene RIF (13)

PMID Text
26523972 MARCH8 is highly expressed in terminally differentiated myeloid cells, and that it is a potent antiviral protein that targets viral envelope glycoproteins and reduces their incorporation into virions.
23606747 MARCH 8 mediates the ubiquitination and lysosomal degradation of the transferrin receptor.
23300075 endogenous MARCH-8 regulates the steady-state cell surface expression of TRAIL-R1.
23170932 Expression of MARCH-8 inhibits HLA-DR-mediated enhancement of mature Gag products internalization by downregulating cell surface HLA-DR
22904187 MARCH8-mediated polyubiquitination and degradation of IL1RAP is an important mechanism for negative regulation of IL-1beta-induced signaling pathways.
22082156 Knockdown of membrane-associated ring finger (C3HC4) 8, E3 ubiquitin protein ligase (MARCH8) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21757542 MARCH8 expression led to direct ubiquitination of CD98 and routing of CD98 to late endosomes/lysosomes
21752829 MARCH8 protein localizes in lysosomes in HeLa cells
21151997 Membrane-Associated RING-CH proteins MARCH VIII and MARCH IV associate with Bap31 and target CD81 and CD44 to lysosomes
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18096478 Of the classifier's 11 informative genes, expression of MIR and WDR40 showed statistically significant increases for both Grade 1B and Grade >or=3A rejection.
16385451 Observational study of gene-disease association. (HuGE Navigator)
12582153 c-MIR induced specific down-regulation of B7-2 surface expression through ubiquitination, rapid endocytosis, and lysosomal degradation

AA Sequence

MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRT      1 - 70
SITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLR     71 - 140
KWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTKLVVVAIGFTG    141 - 210
GLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTE    211 - 280
PEDTGAEIIHV                                                               281 - 291
//

Text Mined References (27)

PMID Year Title
26523972 2015 MARCH8 inhibits HIV-1 infection by reducing virion incorporation of envelope glycoproteins.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23606747 2013 Membrane-associated RING-CH (MARCH) 8 mediates the ubiquitination and lysosomal degradation of the transferrin receptor.
23300075 2013 Ubiquitination by the membrane-associated RING-CH-8 (MARCH-8) ligase controls steady-state cell surface expression of tumor necrosis factor-related apoptosis inducing ligand (TRAIL) receptor 1.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22904187 2012 The E3 ubiquitin ligase MARCH8 negatively regulates IL-1?-induced NF-?B activation by targeting the IL1RAP coreceptor for ubiquitination and degradation.
21757542 2011 MARCH ubiquitin ligases alter the itinerary of clathrin-independent cargo from recycling to degradation.
21752829 2011 Characterization of the CLEAR network reveals an integrated control of cellular clearance pathways.
21151997 2010 Membrane-Associated RING-CH proteins associate with Bap31 and target CD81 and CD44 to lysosomes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
19566897 2009 Sorting of MHC class II molecules into exosomes through a ubiquitin-independent pathway.
19117940 2009 The HLA-DRalpha chain is modified by polyubiquitination.
18389477 2008 Interleukin-10-induced MARCH1 mediates intracellular sequestration of MHC class II in monocytes.
18096478 2007 Gene expression profiling distinguishes a molecular signature for grade 1B mild acute cellular rejection in cardiac allograft recipients.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14722266 2004 Downregulation of major histocompatibility complex class I by human ubiquitin ligases related to viral immune evasion proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12582153 2003 c-MIR, a human E3 ubiquitin ligase, is a functional homolog of herpesvirus proteins MIR1 and MIR2 and has similar activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.