Property Summary

NCBI Gene PubMed Count 20
PubMed Score 43.91
PubTator Score 112.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 1.900 1.1e-02
Waldenstrons macroglobulinemia 1.114 1.2e-02
malignant mesothelioma 2.100 7.6e-07
astrocytic glioma -1.500 5.3e-04
posterior fossa group A ependymoma -2.400 1.7e-17
oligodendroglioma -1.600 4.4e-03
permanent atrial fibrillation -1.300 1.0e-03
psoriasis -1.200 1.7e-03
glioblastoma -2.600 3.9e-09
osteosarcoma 2.716 1.6e-04
sonic hedgehog group medulloblastoma -1.600 1.1e-05
atypical teratoid / rhabdoid tumor -2.500 2.1e-09
medulloblastoma, large-cell -2.100 5.4e-07
primitive neuroectodermal tumor -1.300 6.8e-03
non-small cell lung cancer 1.227 1.1e-19
pediatric high grade glioma -2.300 3.0e-10
pilocytic astrocytoma -2.200 2.7e-11
subependymal giant cell astrocytoma -2.056 2.4e-02
invasive ductal carcinoma 1.200 2.3e-03
ovarian cancer 2.300 5.5e-06
Gaucher disease type 1 -1.200 2.0e-02

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (5)

PMID Text
26527619 Loss of MARCH6 increases expression of SREBP-regulated genes involved in cholesterol biosynthesis and lipoprotein uptake.
24840124 Data suggest that unsaturated fatty acids (oleate; oleoyl-CoA) stabilize SM/SQLE (squalene monooxygenase; catalyzes 1st oxygenation step in cholesterol synthesis) most likely via inhibition of poly-ubiquitination by MARCH6.
24449766 MARCH6 and squalene monooxygenase (SM) physically interact, and consistent with MARCH6 acting as an E3 ligase, its overexpression reduces SM abundance in a RING-dependent manner.
19651899 TEB4 interacts with and mediates loss of type 2 iodothyronine deiodinase (D2)activity, indicating that D2 ubiquitination and degradation can be tissue specific, depending on WSB-1 and TEB4 expression levels.
16373356 analysis of yeast endoplasmic reticulum-localized ubiquitin ligase Doa10 and comparison with its human ortholog TEB4

AA Sequence

MDTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMP      1 - 70
SRLPIQDIFAGLVTSIGTAIRYWFHYTLVAFAWLGVVPLTACRIYKCLFTGSVSSLLTLPLDMLSTENLL     71 - 140
ADCLQGCFVVTCTLCAFISLVWLREQIVHGGAPIWLEHAAPPFNAAGHHQNEAPAGGNGAENVAADQPAN    141 - 210
PPAENAVVGENPDAQDDQAEEEEEDNEEEDDAGVEDAADANNGAQDDMNWNALEWDRAAEELTWERMLGL    211 - 280
DGSLVFLEHVFWVVSLNTLFILVFAFCPYHIGHFSLVGLGFEEHVQASHFEGLITTIVGYILLAITLIIC    281 - 350
HGLATLVKFHRSRRLLGVCYIVVKVSLLVVVEIGVFPLICGWWLDICSLEMFDATLKDRELSFQSAPGTT    351 - 420
MFLHWLVGMVYVFYFASFILLLREVLRPGVLWFLRNLNDPDFNPVQEMIHLPIYRHLRRFILSVIVFGSI    421 - 490
VLLMLWLPIRIIKSVLPNFLPYNVMLYSDAPVSELSLELLLLQVVLPALLEQGHTRQWLKGLVRAWTVTA    491 - 560
GYLLDLHSYLLGDQEENENSANQQVNNNQHARNNNAIPVVGEGLHAAHQAILQQGGPVGFQPYRRPLNFP    561 - 630
LRIFLLIVFMCITLLIASLICLTLPVFAGRWLMSFWTGTAKIHELYTAACGLYVCWLTIRAVTVMVAWMP    631 - 700
QGRRVIFQKVKEWSLMIMKTLIVAVLLAGVVPLLLGLLFELVIVAPLRVPLDQTPLFYPWQDWALGVLHA    701 - 770
KIIAAITLMGPQWWLKTVIEQVYANGIRNIDLHYIVRKLAAPVISVLLLSLCVPYVIASGVVPLLGVTAE    771 - 840
MQNLVHRRIYPFLLMVVVLMAILSFQVRQFKRLYEHIKNDKYLVGQRLVNYERKSGKQGSSPPPPQSSQE    841 - 910
//

Text Mined References (22)

PMID Year Title
26527619 2015 A MARCH6 and IDOL E3 Ubiquitin Ligase Circuit Uncouples Cholesterol Synthesis from Lipoprotein Uptake in Hepatocytes.
25088257 2014 Ubiquitin-specific protease 19 regulates the stability of the E3 ubiquitin ligase MARCH6.
24840124 2014 Squalene mono-oxygenase, a key enzyme in cholesterol synthesis, is stabilized by unsaturated fatty acids.
24449766 2014 The E3 ubiquitin ligase MARCH6 degrades squalene monooxygenase and affects 3-hydroxy-3-methyl-glutaryl coenzyme A reductase and the cholesterol synthesis pathway.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22446040 2012 A novel locus for body mass index on 5p15.2: a meta-analysis of two genome-wide association studies.
21679772 2011 Type 2 deiodinase at the crossroads of thyroid hormone action.
19946888 2010 Defining the membrane proteome of NK cells.
19651899 2009 The E3 ubiquitin ligase TEB4 mediates degradation of type 2 iodothyronine deiodinase.
19103148 2009 CYP3A4 ubiquitination by gp78 (the tumor autocrine motility factor receptor, AMFR) and CHIP E3 ligases.
18798335 2008 Degradation of the bile salt export pump at endoplasmic reticulum in progressive familial intrahepatic cholestasis type II.
16373356 2006 Membrane topology of the yeast endoplasmic reticulum-localized ubiquitin ligase Doa10 and comparison with its human ortholog TEB4 (MARCH-VI).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15673284 2005 TEB4 is a C4HC3 RING finger-containing ubiquitin ligase of the endoplasmic reticulum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14722266 2004 Downregulation of major histocompatibility complex class I by human ubiquitin ligases related to viral immune evasion proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11641273 2001 A conserved ubiquitin ligase of the nuclear envelope/endoplasmic reticulum that functions in both ER-associated and Matalpha2 repressor degradation.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9049630 1997 Isolation of cDNAs from the Cri-du-chat critical region by direct screening of a chromosome 5-specific cDNA library.