Property Summary

NCBI Gene PubMed Count 7
PubMed Score 27.52
PubTator Score 106.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.300 1.5e-06
esophageal adenocarcinoma 1.100 3.9e-02
astrocytoma 1.500 2.6e-21
glioblastoma multiforme 1.100 4.3e-15
oligodendroglioma 1.200 1.8e-09
osteosarcoma -2.420 1.8e-06
cystic fibrosis 1.274 7.7e-05
atypical teratoid/rhabdoid tumor -1.400 3.0e-03
medulloblastoma, large-cell -1.900 4.4e-05
Atopic dermatitis -1.600 5.0e-05
tuberculosis -2.000 3.2e-06
lung cancer -1.600 4.6e-05
interstitial cystitis 1.300 3.6e-05
group 4 medulloblastoma -1.400 4.7e-03

Gene RIF (1)

PMID Text
26694610 LPS activation of TLR4 significantly increased MARCH3 expression and that siRNA against MARCH3 prevented the decrease in FcgammaRIIb following LPS treatment.

AA Sequence

MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLATQSPFNDRPM      1 - 70
CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQH     71 - 140
EKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRLEAVGLIALTVALFTIYLFWTLVSFRYHCRL    141 - 210
YNEWRRTNQRVILLIPKSVNVPSNQPSLLGLHSVKRNSKETVV                               211 - 253
//

Text Mined References (10)

PMID Year Title
26694610 2016 Toll-like Receptor 4 Ligands Down-regulate Fc? Receptor IIb (Fc?RIIb) via MARCH3 Protein-mediated Ubiquitination.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
16428329 2006 MARCH-III Is a novel component of endosomes with properties similar to those of MARCH-II.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14722266 2004 Downregulation of major histocompatibility complex class I by human ubiquitin ligases related to viral immune evasion proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.