Property Summary

NCBI Gene PubMed Count 29
PubMed Score 11.74
PubTator Score 4.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -2.500 1.5e-06
astrocytic glioma -2.100 3.5e-03
psoriasis -1.200 4.7e-10
osteosarcoma -1.338 2.1e-02
medulloblastoma -1.300 8.2e-03
atypical teratoid / rhabdoid tumor -1.200 1.8e-02
medulloblastoma, large-cell -2.600 9.1e-05
primitive neuroectodermal tumor -1.600 1.1e-02
pancreatic ductal adenocarcinoma liver m... -2.256 3.9e-04
non-small cell lung cancer -2.515 2.6e-30
lung cancer -2.100 8.0e-05
colon cancer -1.800 3.2e-02
lung adenocarcinoma -1.400 4.0e-15
posterior fossa group B ependymoma 1.100 3.2e-07
lung carcinoma -1.400 1.5e-12
Pick disease -1.200 2.0e-04
gastric carcinoma -1.400 1.9e-02
ductal carcinoma in situ -1.200 1.0e-03
invasive ductal carcinoma -1.700 2.9e-02
ulcerative colitis -1.400 1.0e-05
ovarian cancer -1.100 8.1e-04
pituitary cancer 1.800 7.4e-07

Gene RIF (11)

PMID Text
25713076 mARC2 has a pivotal role in protecting human cells against apoptotic effects of the base analog N6-hydroxylaminopurine.
24500710 human mARC-1 and mARC-2 are capable of catalyzing reduction of nitrite to NO through reaction with its molybdenum cofactor
24423752 Functional characteristics of protein variants encoded by nonsynonymous single nucleotide polymorphisms in MARC1 and MARC2 in healthy Caucasians were determined.
23703616 Data indicate that mitochondrial amidoxime reducing components 1 and 2 together with the electron transport proteins NADH-cytochrome b5 reductase (CYB5R) and cytochrome b5 (CYB5) catalyze the reduction of N-hydroxylated compounds such as amidoximes.
21916412 analysis of the nature of ligands in the Mo(V) state of the active site of mARC-2
21803866 Chlamydomonas reinhardtii ARC has a Zn-dependent activity and protein partners similar to human MARC1 and MARC2.
21029045 results provide the first hints that mARC might be involved in mitochondrial N(omega)-hydroxy-L-arginine reduction and could be of physiological significance in affecting endogenous nitric oxide levels.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20861021 Arc1(MOSC-1) and Arc2(MOSC-2) proteins are monomeric in their active forms.
20808825 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGASSSSALARLGLPARPWPRWLGVAALGLAAVALGTVAWRRAWPRRRRRLQQVGTVAKLWIYPVKSCKG      1 - 70
VPVSEAECTAMGLRSGNLRDRFWLVIKEDGHMVTARQEPRLVLISIIYENNCLIFRAPDMDQLVLPSKQP     71 - 140
SSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTLDQNFQVAYPDYC    141 - 210
PLLIMTDASLVDLNTRMEKKMKMENFRPNIVVTGCDAFEEDTWDELLIGSVEVKKVMACPRCILTTVDPD    211 - 280
TGVIDRKQPLDTLKSYRLCDPSERELYKLSPLFGIYYSVEKIGSLRVGDPVYRMV                   281 - 335
//

Text Mined References (33)

PMID Year Title
26378779 2015 Expression and Function of mARC: Roles in Lipogenesis and Metabolic Activation of Ximelagatran.
25713076 2015 The pivotal role of the mitochondrial amidoxime reducing component 2 in protecting human cells against apoptotic effects of the base analog N6-hydroxylaminopurine.
25621951 2015 USP30 and parkin homeostatically regulate atypical ubiquitin chains on mitochondria.
25425164 2015 The mammalian molybdenum enzymes of mARC.
25045021 2014 The mitochondrial amidoxime reducing component (mARC): involvement in metabolic reduction of N-oxides, oximes and N-hydroxyamidinohydrazones.
24500710 2014 Nitrite reductase and nitric-oxide synthase activity of the mitochondrial molybdopterin enzymes mARC1 and mARC2.
24423752 2014 Functional characterization of protein variants encoded by nonsynonymous single nucleotide polymorphisms in MARC1 and MARC2 in healthy Caucasians.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23703616 2013 The involvement of mitochondrial amidoxime reducing components 1 and 2 and mitochondrial cytochrome b5 in N-reductive metabolism in human cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23086957 2012 The mitochondrial amidoxime-reducing component (mARC1) is a novel signal-anchored protein of the outer mitochondrial membrane.
22924387 2012 The mitochondrial Amidoxime Reducing Component (mARC) is involved in detoxification of N-hydroxylated base analogues.
21916412 2011 Structural studies of the molybdenum center of mitochondrial amidoxime reducing component (mARC) by pulsed EPR spectroscopy and 17O-labeling.
21803866 2011 The Chlamydomonas reinhardtii molybdenum cofactor enzyme crARC has a Zn-dependent activity and protein partners similar to those of its human homologue.
21269460 2011 Initial characterization of the human central proteome.
21029045 2011 Reduction of N(?)-hydroxy-L-arginine by the mitochondrial amidoxime reducing component (mARC).
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20861021 2010 Biochemical and spectroscopic characterization of the human mitochondrial amidoxime reducing components hmARC-1 and hmARC-2 suggests the existence of a new molybdenum enzyme family in eukaryotes.
20808825 2010 Novel association strategy with copy number variation for identifying new risk Loci of human diseases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19875103 2010 Genomewide association study of movement-related adverse antipsychotic effects.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16973608 2006 Identification of the missing component in the mitochondrial benzamidoxime prodrug-converting system as a novel molybdenum enzyme.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11886751 2002 MOSC domains: ancient, predicted sulfur-carrier domains, present in diverse metal-sulfur cluster biosynthesis proteins including Molybdenum cofactor sulfurases.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.