Property Summary

NCBI Gene PubMed Count 29
PubMed Score 11.74
PubTator Score 4.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -1.200 1.4e-02
atypical teratoid / rhabdoid tumor -1.200 1.8e-02
colon cancer -1.800 3.2e-02
ductal carcinoma in situ -1.200 1.0e-03
gastric carcinoma -1.200 2.7e-02
group 3 medulloblastoma -1.200 4.8e-02
invasive ductal carcinoma -1.700 2.9e-02
lung adenocarcinoma -1.400 4.0e-15
lung cancer -1.800 1.7e-04
lung carcinoma -1.400 1.5e-12
malignant mesothelioma -2.100 4.0e-07
medulloblastoma, large-cell -1.400 1.3e-03
non-small cell lung cancer -1.444 1.3e-21
osteosarcoma -1.338 2.1e-02
ovarian cancer -1.100 8.1e-04
pancreatic ductal adenocarcinoma liver m... -2.256 3.9e-04
Pick disease -1.200 2.0e-04
pituitary cancer 1.100 5.2e-05
posterior fossa group B ependymoma 1.100 3.2e-07
primitive neuroectodermal tumor -1.600 1.1e-02
psoriasis -1.200 4.7e-10
ulcerative colitis -1.400 1.0e-05

Gene RIF (11)

AA Sequence

MGASSSSALARLGLPARPWPRWLGVAALGLAAVALGTVAWRRAWPRRRRRLQQVGTVAKLWIYPVKSCKG      1 - 70
VPVSEAECTAMGLRSGNLRDRFWLVIKEDGHMVTARQEPRLVLISIIYENNCLIFRAPDMDQLVLPSKQP     71 - 140
SSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTLDQNFQVAYPDYC    141 - 210
PLLIMTDASLVDLNTRMEKKMKMENFRPNIVVTGCDAFEEDTWDELLIGSVEVKKVMACPRCILTTVDPD    211 - 280
TGVIDRKQPLDTLKSYRLCDPSERELYKLSPLFGIYYSVEKIGSLRVGDPVYRMV                   281 - 335
//

Text Mined References (33)

PMID Year Title