Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.55
PubTator Score 6.26

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -2.464 3.7e-04
medulloblastoma, large-cell 1.100 3.0e-05
tuberculosis 2.300 1.2e-07
interstitial cystitis -1.100 2.9e-03
group 3 medulloblastoma 1.200 1.4e-04
ductal carcinoma in situ -2.500 2.7e-04
invasive ductal carcinoma -2.500 3.0e-03
ovarian cancer 1.200 5.4e-07
psoriasis -1.400 4.5e-38

Gene RIF (9)

PMID Text
24500710 human mARC-1 and mARC-2 are capable of catalyzing reduction of nitrite to NO through reaction with its molybdenum cofactor
24423752 Functional characteristics of protein variants encoded by nonsynonymous single nucleotide polymorphisms in MARC1 and MARC2 in healthy Caucasians were determined.
23703616 Data indicate that mitochondrial amidoxime reducing components 1 and 2 together with the electron transport proteins NADH-cytochrome b5 reductase (CYB5R) and cytochrome b5 (CYB5) catalyze the reduction of N-hydroxylated compounds such as amidoximes.
23086957 The transmembrane domain of mARC1 shown to be sufficient for mitochondrial targeting and the N-terminal targeting signal to function as a supportive receptor for the outer mitochondrial membrane.
21803866 Chlamydomonas reinhardtii ARC has a Zn-dependent activity and protein partners similar to human MARC1 and MARC2.
21029045 results provide the first hints that mARC might be involved in mitochondrial N(omega)-hydroxy-L-arginine reduction and could be of physiological significance in affecting endogenous nitric oxide levels
20877624 Observational study of gene-disease association. (HuGE Navigator)
20861021 Arc1(MOSC-1) and Arc2(MOSC-2) proteins are monomeric in their active forms.
19053771 molybdoprotein mARC1 is involved in the activation of N-hydroxylated prodrugs.

AA Sequence

MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQLWIYPVKSCK      1 - 70
GVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKT     71 - 140
PTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDT    141 - 210
SPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDP    211 - 280
DTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQ                 281 - 337
//

Text Mined References (23)

PMID Year Title
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24500710 2014 Nitrite reductase and nitric-oxide synthase activity of the mitochondrial molybdopterin enzymes mARC1 and mARC2.
24423752 2014 Functional characterization of protein variants encoded by nonsynonymous single nucleotide polymorphisms in MARC1 and MARC2 in healthy Caucasians.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23703616 2013 The involvement of mitochondrial amidoxime reducing components 1 and 2 and mitochondrial cytochrome b5 in N-reductive metabolism in human cells.
23086957 2012 The mitochondrial amidoxime-reducing component (mARC1) is a novel signal-anchored protein of the outer mitochondrial membrane.
21803866 2011 The Chlamydomonas reinhardtii molybdenum cofactor enzyme crARC has a Zn-dependent activity and protein partners similar to those of its human homologue.
21493818 2011 Genetic and clinical correlates of early-outgrowth colony-forming units.
21326311 2011 Genome-wide association study identifies genetic variants influencing F-cell levels in sickle-cell patients.
21269460 2011 Initial characterization of the human central proteome.
21029045 2011 Reduction of N(?)-hydroxy-L-arginine by the mitochondrial amidoxime reducing component (mARC).
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20861021 2010 Biochemical and spectroscopic characterization of the human mitochondrial amidoxime reducing components hmARC-1 and hmARC-2 suggests the existence of a new molybdenum enzyme family in eukaryotes.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
19053771 2008 The fourth molybdenum containing enzyme mARC: cloning and involvement in the activation of N-hydroxylated prodrugs.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11886751 2002 MOSC domains: ancient, predicted sulfur-carrier domains, present in diverse metal-sulfur cluster biosynthesis proteins including Molybdenum cofactor sulfurases.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.