Property Summary

Ligand Count 2,287
NCBI Gene PubMed Count 1,371
PubMed Score 7239.29
PubTator Score 1699.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Amyotrophic lateral sclerosis 451
Abnormal brain FDG positron emission tomography 9
Adult onset 82
Aggressive behavior 75
Aggressive reaction 75
Akinesia 13
Alexia 6
Anxiety 136
Anxiety disease 113
Apathy 16
Apraxia of eyelid 2
Apraxias 27
Axial dystonia 3
Bipolar Disorder 666
Blurred vision 19
Bradykinesia 34
Compulsive hoarding 7
Cortical white matter abnormalities seen on MRI 18
Deglutition Disorders 132
Dementia of frontal lobe type 6
Depressive disorder 409
Developmental arithmetic disorder 8
Difficulty making arithmetical calculations 8
Diplopia 8
Dysarthria 192
Dysgraphia 20
Dyslexia 43
Dysphasia 23
EEG with continuous slow activity 7
Echolalia 12
Excess nuchal skin 30
Forgetful 40
Frontolimbic dementia 1
Frontotemporal cerebral atrophy 8
Gait imbalance 17
Gliosis 56
Grammar-specific speech disorder 6
Granulovacuolar degeneration 1
Hyperorality 7
Hyperphagia 23
Inappropriate laughter 4
Inappropriate sexual behavior 2
Increased appetite (finding) 23
Irritation - emotion 68
Isolated cases 72
Kyphoscoliosis deformity of spine 60
Language Disorders 13
Leukoaraiosis 18
Loss of speech 16
Memory Loss 40
Memory impairment 40
Morphological abnormality of the pyramidal tract 12
Muscle Rigidity 49
Mutism 17
Neurodegenerative Disorders 79
Neurofibrillary degeneration (morphologic abnormality) 9
Neuronal loss 25
Ophthalmoparesis 11
Personality change 23
Photodysphoria 121
Photophobia 121
Physical aggression 76
Poor speech 37
Primary Progressive Nonfluent Aphasia 7
Primitive reflexes (palmomental, snout, glabellar) 7
Problems speaking 37
Pyramidal sign 29
Pyramidal tract disease 12
Repeated speech 9
Restlessness 14
Restrictive behavior 7
Restrictive behavior, interests, and activities 7
Retrocollis 2
Semantic Dementia 7
Social disinhibition 14
Spoken Word Recognition Deficit 6
Stereotyped Behavior 37
Stereotypic Movement Disorder 42
Supranuclear Palsy, Progressive, 1, Atypical 1
Supranuclear gaze palsy 6
Temporal cortical atrophy 6
Tremor 113
Weight decreased 103
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.100 9.9e-06
Astrocytoma, Pilocytic -1.700 8.1e-07
atypical teratoid / rhabdoid tumor -3.100 2.9e-08
Breast cancer -1.200 2.2e-05
cutaneous lupus erythematosus -1.500 1.2e-02
ependymoma -1.800 1.9e-08
glioblastoma -1.600 3.6e-05
group 3 medulloblastoma -1.200 6.3e-04
lung carcinoma 2.900 7.8e-49
medulloblastoma, large-cell -2.700 2.0e-05
oligodendroglioma 1.400 1.9e-02
osteosarcoma 1.752 4.1e-06
ovarian cancer -1.400 5.8e-09
Pick disease -1.100 4.0e-04
psoriasis -1.600 1.4e-06
subependymal giant cell astrocytoma -2.066 5.9e-03

Protein-protein Interaction (2)

Gene RIF (1264)

AA Sequence

MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTP      1 - 70
TAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREP     71 - 140
GPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEGPPLKGAGGKE    141 - 210
RPGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIP    211 - 280
ASEPDGPSVGRAKGQDAPLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEAD    281 - 350
LPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS    351 - 420
DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQKGQANATRIPA    421 - 490
KTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRL    491 - 560
QTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPV    561 - 630
DLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAK    631 - 700
AKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL                701 - 758
//

Text Mined References (1389)

PMID Year Title