Property Summary

NCBI Gene PubMed Count 1,248
PubMed Score 6601.97
PubTator Score 1699.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Progressive supranuclear palsy 1 1

Expression

  Differential Expression (16)

Disease log2 FC p
oligodendroglioma 1.400 1.9e-02
psoriasis -1.600 1.4e-06
cutaneous lupus erythematosus -1.500 1.2e-02
glioblastoma -2.300 6.0e-03
osteosarcoma 1.752 4.1e-06
ependymoma -1.900 3.1e-09
medulloblastoma -1.700 1.3e-04
atypical teratoid / rhabdoid tumor -3.200 2.4e-05
medulloblastoma, large-cell -2.700 2.0e-05
adult high grade glioma -2.200 4.9e-05
pilocytic astrocytoma -1.600 1.5e-06
subependymal giant cell astrocytoma -2.066 5.9e-03
inflammatory breast cancer -2.500 2.7e-02
lung carcinoma 2.900 7.8e-49
Pick disease -1.100 4.0e-04
ovarian cancer -1.400 5.8e-09

Protein-protein Interaction (2)

Gene RIF (1148)

PMID Text
27129267 tau inclusions are dynamic structures constantly undergoing "fission" and "fusion," which facilitate stable propagation of tau pathology in dividing cells.
27118310 that the mutant Tau(A152T) induces neuronal dysfunction, morphological alterations in neurons akin to aging phenotype and reduced life-span independently of aggregation
27100392 Mutations in tau gene is the genetic causes of frontotemporal lobar degeneration.
27030011 This study demonstrates that extracellular vesicles can transmit tau pathology.
27023670 These results suggest that stabilization of microtubule-unbound tau by phosphorylation at Ser262/356 via the PAR-1/MARK may act in the initial steps of tau mismetabolism in AD pathogenesis
26916334 The hTau40(AT) mice mimic pathological hallmarks of tauopathies including a cognitive phenotype combined with pronounced neuroinflammation visible by bioluminescence.
26903089 The capacity FKBP52 to oligomerize Tau is not linked to its peptidyl-prolyl isomerase activity.
26876913 CSF concentrations of T-tau and P-tau in bipolar disorder-mild cognitive impairment patients were similar to those in controls, and significantly lower than those in Alzheimer disease.
26852117 Multiple signaling factors and drugs alleviate neuronal death induced by expression of human and zebrafish tau proteins in vivo.
26824039 MAPT may play an important role in insulin granule trafficking and indicate the importance of balanced MAPT phosphorylation and dephosphorylation for adequate insulin release.
26751496 Data show tau protein localized to the nucleus and interacts with the DNA to protect the genome supporting the idea that aberrant modification like in Alzheimer's disease could alter its function and enhance genome vulnerability. [review]
26751494 Results show tau deposits with complicated characteristics because of different isoform composition, histopathology, and ultrastructure in various neurodegenerative conditions. [review]
26751493 Data show increasing evidence that abnormal forms of tau protein are directly involved in the initiation of neurodegenerative processes. [review]
26742856 Data show that targeted high-resolution mass spectrometry (MS)-based strategy can quantify tau in cerebrospinal fluid (CSF) and could be applied to tau monitoring in CSF.
26712030 the structural and dynamic characteristics of transiently evolving protein aggregates and interprotein packing as a function of aggregation time, along the third repeat domain and C terminus of Deltatau187 of human tau, is reported.
26704708 Results suggest that TauC3 facilitates early memory impairment in transgenic mice accompanied with tau oligomer formation
26701291 Leptin resistance-induced obesity and diabetes accelerates the development of tau pathology
26682901 CSF biomarkers NFL and T-tau both reflect development of SCI after endovascular aortic repair, but do not rise until after clinical signs of SCI appear
26655856 Although the can detect and identify some minor conformers in the cis form, they show that all prolines are for over 90% in the trans conformation.
26621125 Results of the present study demonstrate the influence of extracellular matrix and especially perineuronal nets on dispersion and internalization of exogenously applied Tau-protein
26608845 tau also forms non-toxic insoluble oligomers in vivo in addition to toxic oligomers.
26601739 Its genetic variation influences Parkinson disease risk, age of onset, and progression.
26581847 transgenic Drosophila models of AD expressing wild-type and mutant forms of hMAPT exhibit a progressive neurodegeneration which was manifested in the form of early death and impairment of cognitive ability
26576485 This study demontrated that Neuronal expression of pathological tau accelerates oligodendrocyte progenitor cell differentiation.
26556772 Results showed that phosphorylated tau is not an exclusive biomarker of neuropathological changes in post-traumatic brain but also a finding in epileptics without a history of repetitive traumatic brain injury
26542680 These findings suggest an isoform-dependent biological role for regulation by Tau, with longer isoforms conferring microtubule steric stabilization.
26540742 Results of this study showed that there was no deficit in the performance of the TgTauP301L compared to the wild type mice and there had been no change in the animals' performance compared to at 5-months.
26538150 Study showed that the banding patterns of C-terminal fragments of tau are different among different tauopathies, and the trypsin-resistant band patterns are also distinct among the diseases
26534959 Tat associates with TAU RNA, further demonstrating that Tat interferes with host RNA metabolism in the absence of viral infection.
26473392 FTD patients with MAPT mutation were younger, and showed more behavioral disinhibition, repetitive and stereotyped behaviours, semantic impairment and temporal predominance of atrophy. MAPT cases had tau pathology.
26444794 The results of this study suggest that the MAPT H1 haplotype increases the risk of Parkinson's disease (PD),progressive supranuclear palsy , and non-APOE varepsilon4 Late-Onset Alzheimer's Disease.
26426266 study found a novel mutation (c.1008G>C, p.Q336H) in a patient with Pick disease(PiD); findings indicate p.Q336H mutation in exon 12 of MAPT causes hereditary PiD with neuropathologic, biochemical and clinical phenotype indistinguishable from sporadic PiD
26408675 Studies showed that high tau protein expression is associated with a good prognosis in breast cancer but its predictive value for response to chemotherapy remains uncertain, mostly due to interaction with ER status. [review]
26403791 This article reviews the current knowledge and hypotheses from relevant studies on tau toxicity, emphasizing the roles of phosphorylations, metal ions, folding and clearance control underlining tau etiology and their regulations. [review]
26402096 Selective identification of ER proteins that associate with tau in Alzheimer's Disease and control brains
26381172 investigated the basic tau protein structure of wild-type (WT) and tau proteins with lysine residues mutation at glutamic residue (Q2K) on tau protein at atomistic scale
26373282 Neural stem cells from patients with the N279K tau mutation displayed impaired endocytic trafficking. Flotillin-1 was significantly increased in frontal and temporal, but not occipital, cortices of PPND/FTDP-17 patients with this mutation.
26333800 MAPT p.A152T is a rare low penetrance variant associated with Lewy Body Disease.
26330509 This article gives a brief history of tau and the current understanding of tau in neurodegenerative diseases.
26297556 The results strongly suggests that the MAPT c.915 +15 A>C variant is a pathogenic mutation and that it causes frontotemporal dementia with parkinsonism linked to chromosome 17 (FTDP-17) in this pedigree by shifting tau transcription to overproduce 4R tau similar to other FTDP-17 mutations.
26269332 The human Tau interactome binding to the ribonucleoproteome, to chaperones and the proteasome has been reported.
26268594 LRRK2 facilitates tau phosphorylation indirectly by recruiting tau or cdk5 rather than by directly phosphorylating tau
26258756 Reduced miR-512 and the elevated expression of its targets cFLIP and MCL1 localize to neurons with hyperphosphorylated Tau protein in Alzheimer disease.
26237304 The total tau concentration relates to symptoms of postconcussive disorder
26220942 The previously unreported faster maturation of MAPT mutant human neurons, the developmental expression of 4R tau and the morphological alterations may contribute to disease development.
26200045 We report on a female patient presenting with primary progressive aphasia and her brother presenting with psychosis. Both siblings had an R5H-mutation in exon 1 of the MAPT-gene
26198711 Sex steroid hormones distinctively increase mitochondrial bioenergetics in APP/ABETA and TAU-overexpressing cells.
26177386 These findings suggest that, in addition to mediating fibrillization, cofactors decorating the surface of Tau fibrils may modulate biological interactions and thereby influence the spreading of Tau pathology in the human brain.
26176913 cis P-tau is a major early driver of disease after TBI and leads to tauopathy in chronic traumatic encephalopathy and Alzheimer's disease
26170022 MAPT gene expression, including repeated motifs, CpG island/methylation, haplotypes at the DNA level, key regions involved in mRNA expression and stability, and the splicing patterns of different mRNA isoforms are reviewed. Review.
26165593 Atomic structure has shown that phosphorylated Tau threonine231 selectively engages in a salt bridge with arginine230.
26161867 these data support a role for the activation of caspase-3 and proteolytic cleavage of Tau antibody in vascular dementia.
26143746 These findings indicate distinct neurodegenerative changes in FTD caused by mutant TAU and highlight the unique opportunity to use neurons differentiated from patient-specific iPSCs to identify potential targets for drug screening .
26134402 the difference of only two amino acids in tau and MAP2 sequences may determine their different fates in tauopathies
26119563 Data show that activation of EphB2 receptor kinase arrests tau protein hyperphosphorylation through phosphatidylinositol 3-kinase (PI3K)/Akt protein-mediated glycogen synthase kinase-3beta (GSK-3beta) inhibition.
26103986 Data show that overexpression of the 14-3-3sigma isoform resulted in a disruption of the tubulin cytoskeleton mediated by binding Tau protein.
26083267 In this review the current knowledge of the role of TAU and protein aggregate formation in oligodendrocyte cell culture systems is summarized. [review]
26077951 MAPT is associated with corticobasal degeneration.
26034266 Tau binds to microtubules via small groups of evolutionary conserved residues. The binding sites are formed by residues essential for the pathological aggregation of Tau, suggesting competition between physiological interaction and pathogenic misfolding.
25998110 clinical characteristics associated with mutations in MAPT often include Behavioral variant of Frontotemporal dementia with parkinsonistic features.The associated brain protein pathology is tau positive.
25982997 Data suggest that tau inclusion pathology follows a non-stochastic process where conformationally distinct misfolded tau fibrils with specific clinico-pathologic properties display differential seeding potential
25974414 the Gln124-Tau fragment displays a stronger ability to bind and stabilize microtubules, suggesting that the Tau N-terminal domain could play a direct role in the regulation of microtubule stabilization.
25963821 tau allows Abeta oligomers to inhibit axonal transport through activation of GSK3beta, possibly by facilitating aberrant neuronal activity.
25960998 This study suggests that, in both ethnic groups, SNCA gene variants influence the age at onset of Parkinson's disease and alpha-synuclein plays a key role in the disease course of PD.MAPT polymorphisms did not enhance such association in either entire cohort
25959626 findings suggest that rescuing LRP5/6-mediated Wnt signaling improves neuronal cell survival and reduces tau phosphorylation, which support the hypothesis that Wnt signaling might be an attractive therapeutic strategy for managing AD
25953777 Our findings therefore highlight a novel important role of tau in the pathogenic process and clinical expression of Huntington's disease.
25930997 POLDIP2 plays a crucial role in Tau aggregation via the impairment of autophagy activity, providing insight into Tau aggregation in Tau pathology.
25918155 findings suggest that truncation/activation of Dyrk1A by Ca(2+)/calpain I might contribute to Tau pathology via promotion of exon 10 exclusion and hyperphosphorylation of Tau in AD brain
25912737 Fibril-forming motifs could be the determinants of Tau protein tending to misfold in living cells, thereby inducing neuronal apoptosis and causing the initiation and development of Alzheimer disease.
25908520 This review synthesizes the current knowledge, the localization and the main functions of the Tau protein focused on the testis. [Review]
25900293 Study showed that pathologically confirmed globular glial tauopathy may be caused by MAPT mutations, a novel MAPT mutation (c.951G>C, p.K317N) is pathogenic
25899925 mutant G309D PINK1 significantly reduced phosphorylation of GSK3beta at serine 9, suggesting that alterations in GSK3beta activity play an essential role in mutant G309D PINK1-induced tau phosphorylation at the PHF-1 site
25895963 changes in serum tau protein levels in patients with EHEC encephalopathy were consistent with abnormalities on brain MRI and were positively correlated with proinflammatory cytokine levels
25887395 results indicate that a clear minimum size (n = 3) of Tau seed exists for spontaneous propagation of Tau aggregation from the outside to the inside of a cell, whereas many larger sizes of soluble aggregates trigger uptake and seeding
25886404 Very high total-tau protein CSF levels were significantly associated with a definitive Creutzfeldt-Jakob disease
25882706 Active Hsc70 requires active tau to regulate microtubule assembly in vivo, suggesting that tau acts in some ways as a co-chaperone for Hsc70 to coordinate microtubule assembly.
25881209 development of tauopathy in rTg4510 mice involves the accumulation of a pool of pathological tau that carries multiple post-translational modifications
25880550 Increased CSF Tau was associated with greater levels of neurocognitive impairment in HIV-associated neurocognitive disorder.
25863528 Accumulation of hyperphosphorylated and aggregated microtubule-associated protein tau (MAPT) is a central feature of a class of neurodegenerative diseases termed tauopathies.
25863267 A strategy focused on MAPT, APP, NCSTN and BACE1 to build blood classifiers for Alzheimer's disease.
25847153 Study demonstrated that downregulation of tau severely impairs process outgrowth, oligodendrocyte differentiation, and sheet formation, and that MBP mRNA transport to the distal cellular extensions is disturbed
25842390 By interacting with tau at the intracellular level, the 3-O-sulphated heparan sulphates produced by HS3ST2 might act as molecular chaperones allowing the abnormal phosphorylation of tau
25826665 Structural determinants have been defined for alternative splicing regulation of the MAPT pre-mRNA.
25822823 individual effect of six different isoforms of tau on cell proliferation and the possible mechanisms by transient expression of eGFP-labeled tau isoform plasmid
25804954 LRRK2 and tau do not interact to exacerbate behavioral, biochemical or pathological abnormalities in neurodegeneration and that LRRK2 and tau exert their pathogenic effects through independent mechanisms.
25791428 These results have implicated that mTor is involved in regulating tau distribution in subcellular organelles and in the initiation of tau secretion from cells to extracellular space.
25773385 Tau expression was identified as an independent factor to predict the sensitivity of tumors to taxane-containing palliative chemotherapy in recurrent and metastatic breast cancer
25772164 The accumulation of misfolded tau in rat neurons induces overexpression of Hsp27 in astrocytes.
25765123 Mutations in MAPT, one of three genes most commonly associated with FTD are not associated with progressive apraxia of speech (PAOS) and primary progressive aphasia (PPA)
25760044 HIV-1 Tat induces hyperphosphorylation of Tau in neuronal cells
25725586 High Tau-protein and low PTEN expression showed a significant association with poor response to H + P chemotherapy in patients with HER2-positive advanced breast cancer.
25691742 urea halts aggregation, TMAO promotes the formation of compact oligomers (including helical oligomers) through a newly proposed mechanism of redistribution of water around the perimeter of the peptide.
25687773 association of both Alzheimer's disease and Parkinson's disease with the A allele of rs393152 within the extended MAPT region on chromosome 17
25687137 Pathogenetic tau truncation may contribute to synaptic deterioration in Alzheimer disease by aberrant recruitment of Parkin and UCHL-1 to mitochondria.
25659102 An oral administration of PE859 resulted in the significant reduction of sarkosyl-insoluble aggregated tau along with the prevention of onset and progression of the motor dysfunction in JNPL3 P301L-mutated human tau transgenic mice.
25658796 The data suggest that reduction of tau expression may sensitize ovarian carcinoma to the paclitaxel treatment.
25588407 There were significant differences in CSF tau and phosphor-tau between patients with Alzheimer's disease and non-demented controls.
25577413 results suggest that common variation in MAPT is not only associated with the dementia of Parkinson's disease but also differences in the neural circuitry underlying aspects of cognition in normal aging
25575131 This study support the notion that age-related vascular injury or tissue microinfarcts lead to loss of tau proteins with the consequent impact on phosphorylation and accumulation of the neurofibrillary pathology of vascular dementia.
25574843 miR-219 binds directly to the 3'-UTR of the tau mRNA and represses tau synthesis at the post-transcriptional level.
25574752 report suggests that frontotemporal lobar degeneration with IVS10+3G>A MAPT mutation causes damage mainly to the central nervous system
25573097 Thr175-phosphorylated tau induces pathologic fibril formation via GSK3beta-mediated phosphorylation
25524708 Late-appearing phosphorylation on Ser(238) rather than hyperphosphorylation per se is essential for Tau toxicity underlying premature mortality in adult flies.
25476420 Cells treated with exogenous proteasomes are efficient in degrading overexpressed human tau, resulting in decreased levels of tau aggregates.
25468336 The diffusion of bound tau was negligible in vivo, in contrast to an earlier report that tau diffuses along the microtubule lattice in vitro.
25465240 olfactory deprivation by olfactory bulbectomy hastens tau pathology and cholinergic system impairment in htau mice possibly via activation of cdk5.
25443551 Mutations in MAPT in three sib-pairs were identified with progressive supranuclear palsy.
25436420 (-)-epigallocatechin gallate (EGCG), a green tea polyphenol that was previously found to reduce Abeta aggregation, inhibits the aggregation of tau K18DeltaK280 into toxic oligomers at ten- to hundred-fold substoichiometric concentrations
25424384 The clinical utility of the CSF biomarkers amyloid-beta-1-42, t-tau, and p-tau (phosphorylated tau protein) for Alzheimer's disease diagnosis has been well documented; progress in use of these biomarkers for early diagnosis is discussed. [REVIEW]
25416970 Studies suggest that granular tau oligomers may be involved in neuronal loss.
25406315 We show that seeding is conferred by aggregated Tau that enters cells through macropinocytosis and seeds the assembly of endogenous Tau into filaments.
25394490 alpha-Syn and Tau together cooperated with one another to increase the magnitude or rate of phosphorylation of the other by GSK-3beta.
25393609 In brain from Alzheimer's disease patients, tau was found to be highly localized to synaptic terminals in cortex.
25384392 These studies demonstrate that Tau deletion affects intracellular Abeta1-42 clearance, leading to extracellular plaque.
25378699 Tau SUMOylation induces tau hyperphosphorylation at multiple AD-associated sites. Tau hyperphosphorylation promotes its SUMOylation inhibiting tau degradation. Enhanced SUMO-immunoreactivity costains with hyperphosphorylated tau in AD cerebral cortex.
25377499 Results suggest that analyzing of the MAPT gene is essential for diagnosing familial dementia, even if amyloid markers such as Abeta42 in the cerebrospinal fluid and amyloid imaging are positive, or if neuropathological findings indicate a diagnosis of AD.
25339173 Tau highly phosphorylated in cells increases oligomerization without pronounced aggregation.
25331948 Syk regulates amyloid-beta production via NF-kappaB-dependent mechanisms and Tau phosphorylation by controlling the activation of GSK3beta
25330988 Study found normal tau protein to be symmetrically distributed across presynaptic and postsynaptic terminals in the normal human brain; misfolded tau in Alzheimer's disease-affected brains was also symmetrically distributed on both sides of the synapse
25326800 AEP acts as a crucial mediator of tau-related clinical and neuropathological changes.
25319522 Transgenic mice expressing human four-repeat tau lacking the N-terminal sequences (4R0N) with a P301L mutation demonstrated that P301L tau expression increased potassium-evoked glutamate release in the dentate gyrus and CA3 and significantly decreased glutamate clearance and maze learning.
25306292 The H2 allele of the extended MAPT haplotype negatively affects the course of psychotic symptoms in AD independently of disease severity.
25305495 results of this meta-analysis suggested that MAPT_238bp/STH Q7R polymorphisms might modulate the risk of Parkinson's disease susceptibility
25284680 Data suggest that tau protein exhibits polymerization/aggregation in presence of heparin while undergoing two distinct stages of changes in secondary structure in the process of stabile amyloid fibril formation.
25241929 PICALM modulates autophagy activity and tau accumulation
25229151 helical tau structure in the context of intact lipid bilayers
25178429 Variants of MAPT and SNCA were not associated with, but APOE epsilon4 allele was only associated with, lower performance on word list learning and semantic verbal fluency
25151619 This study demonstrated that insoluble phospho-tau species are correlated with PPI deficits in a tau mouse model of Alzheimer disease.
25143394 Results suggests that expression of mutant Htt leads to Tau hyperphosphorylation, relocalization and sequestration through direct protein-protein interactions in inclusion-like compartments in the vicinity of the microtubular organizing center.
25131590 Due to multiple post-translational modifications, heterogeneous tau species with a wide range of apparent molecular masses are implicated in human disease proceses. [Review]
25128526 Inactivation of nuclear localization signal causes retention of I2PP2A in the cell cytoplasm, where it promotes Tau hyperphosphorylation by affecting PP2A signaling.
25112570 Catecholamine-differentiatied cells lack tau and grow neurites in serum-free media. Serum induces neurite retraction. Transfection with green fluorescent protein-Tau conferred resistance to the retraction caused by serum.
25051234 These findings suggest that an intracellular form CLU and BIN1 interaction might impact Tau function in neurons and uncover potential new mechanisms underlying the etiology of Tau pathology in in Alzheimer's disease.
25012224 A probabilistic generative model predicts with high confidence that the cerebrospinal fluid biomarkers become abnormal in a distinct sequence: amyloid-beta1-42, phosphorylated tau, total tau.
25001178 MicroRNA-125b induces tau hyperphosphorylation and cognitive deficits in Alzheimer's disease.
24977637 Isoflurane may induce cognitive dysfunction by enhancing phosphorylation of hippocampal tau protein at Ser262 site, and this effect is more significant in transgenic APP695 mice.
24965601 suggest a protective role for cellular prion protein in Alzheimer's disease by downregulating tau expression, and they point to this protein as being crucial in the molecular events that lead to neurodegeneration in Alzheimer's disease
24929931 The results demonstrate a complex interaction between tau and AICD involving activation of GSK3beta in promoting cell death, and the ability of Hirano bodies to modulate this process.
24923570 MAPT gene has four haplotype blocks in the Taiwanese population, each of around 40 kbp. In both European study and our study, the SNP rs242557 showed association with Alzheimer's disease
24915991 This study show that NFTs do not significantly alter postsynaptic function of the host neurons which is required for the experience-dependent Arc expression.
24909306 Expression of wild type human Tau partially rescued the neurodegenerative phenotype caused by the loss of endogenous dTau, suggesting that the functions of Tau proteins are functionally conserved from flies to humans
24869773 lysine methylation is part of the normal modification signature of tau protein in the human brain. In addition to indirect effects owing to PTM cross-talk, lysine methylation can directly affect tau biology by lowering aggregation propensity.
24865638 In MAPT transgenic mice, memory deficits precede the onset of locomotor dysfunction and coincide with the appearance of conformationally changed, S202-phosphorylated tau and reduced spine density in the absence of neuronal cell loss in the hippocampus.
24861427 We find no predilection or predisposition towards an accompanying TDP-43 pathology in patients with FTLD-tau, irrespective of presence or absence of MAPT mutation, or that genetic changes associated with FTLD-TDP predispose towards excessive tauopathy.
24857020 Prion-like propagation of tau aggregation underlie the stereotyped progression of neurodegenerative tauopathies.
24853415 Suggest that DAPK1 is a novel regulator of tau protein abundance, and that DAPK1 upregulation might contribute to tau-related pathologies in Alzheimer disease.
24825901 Although the repeat domain generally aggregates more readily than full-length Tau, its aggregation was greatly slowed down by phosphorylation or pseudo-phosphorylation at the KXGS motifs, concomitant with an extended phase of oligomerization.
24821615 study describes the P364S MAPT mutation-associated tauopathy clinical course in two sisters, in whom postmortem analysis revealed striking composite neuronal tau inclusions
24818585 Microbleeds are present with cerebrospinal fluid (CSF) beta-amyloid 42 (Abeta42), total tau, and tau phosphorylated at threonine 181 (P-tau181) as well as a subset of apolipoprotein E (APOE) epsilon4 carriers and noncarriers.
24808015 Tauopathy phenotypes include lower motor neuron disease and implicate tau degradation pathway defects in motor neuron degeneration.
24779391 We conclude that the MAPT rs242562 is associated with PD in central China in the background of MAPT H1/H1 diplotype.
24741064 results suggest that tau may be an important biomarker for predicting long-term outcome in patients with severe aneurysmal subarachnoid haemorrhage.
24722794 The sensitivity of gastric cancer patients to paclitaxel treatment was inversely correlated with the mRNA and protein expression of MAPT.
24687422 At low near-physiological levels, Tau is co-transported along with short microtubules from cell bodies into axons by cytoplasmic dynein and kinesin family members at rates of slow axonal transport. [review]
24675496 Based on MAP-tau expression, there was no significant difference in disease-free survival in the breast cancer patients who received anthracycline and taxane-containing adjuvant chemotherapy.
24656848 The results of this study suggest that rs4728029 of modifies the relationship between PTau and both ventricular dilation and cognition, perhaps through an altered neuroinflammatory response
24646911 Data indicate that dysfunction of tau protein may contribute to collapse of cytoskeleton.
24623856 FKBP52 appears to be an endogenous candidate that directly interacts with the pathogenic Tau-P301L and modulates its function in vitro and in vivo
24581495 Study obtained a structural model of Hsp90 in complex with its natural disease-associated substrate, the intrinsically disordered Tau protein. Hsp90 binds to a broad region in Tau that includes the aggregation-prone repeats.
24566866 Combination of increased total-tau levels and increased total tau to phosphorylated-tau serves as a clinically useful diagnostic test for Creutzfeldt-Jakob disease.
24561013 Collectively, these data indicate that autophagic gridlock contributes to the development of pathology in aging and neurodegeneration.
24559644 Variants of the MAPT gene have been suggested to be associated with Parkinson's disease (PD) and to modify the risk for leucine-rich repeat kinase 2 (LRRK2) Parkinsonism.
24559475 OGlcNAcylation of tau opposes neurofibrillary tangle formation, because of its confirmation of the disordered structure of sequences with unmodified serine and threonine residues, while phosphorylation is associated with neurofibrillary tangle formation.
24519386 Tau had no prognostic value in either group.
24502945 A functional fragment of Tau forms bundled ribbon-like fibrils. Nucleation of its fibril formation is faster than for full-length Tau. In contrast to full-length Tau, without cysteines, the fragment still forms fibers.
24498342 Data indicate that neuronal expression of protein Tau affected the functional and structural organization of the entorhinal-hippocampal complex, in particular synapses and myelinated axons in the stratum lacunosum moleculare (SLM) in mice.
24493463 The soluble building blocks of the abnormal brain structures in Alzheimer disease pathogeneisis are tau for neurofibrillary tangles and amyloid-beta (Abeta) peptides for plaques.
24492862 Ratio of phosphorylated to total tau in the cerebrospinal fluid (CSF) is a candidate biomarker providing objective support for diagnosis of amyotrophic lateral sclerosis.
24464041 Heterochromatin loss appears to be a toxic effector of tau-induced neurodegeneration.
24448233 The study provides direct structural information regarding DeltaK280 tau R2 repeat mutant aggregates and their extensions in the N- and C-terminii by one residue.
24444746 O-GlcNAc modification of full-length tau impairs the rate and extent of its aggregation without perturbing its activity toward microtubule polymerization.
24440055 Study seeks to elucidate the Abeta-dependent changes in wild-type human tau that cause synaptic loss and cognitive decline in Alzheimer's disease, focusing on changes in synaptic proteins in the Fyn kinase pathway
24430504 Interactions between alpha-Syn and Tau cause disruption of cytoskeletal organization, axonal transport defects and aberrant synaptic organization that contribute to neuronal dysfunction and death associated with Parkinson's disease.
24406748 This study showed novel P301S tau Tg mouse model of cognition deficies. These mice demonstrate age-dependent abnormalities in tau phosphorylation, insoluble tau accumulation, altered expression of neuronal proteins,motor dysfunction.
24401901 CSF tau protein levels were significantly lower in patients with Alzheimer's subtype posterior cortical atrophy compared to those with amnestic or logopenic progressive aphasia subtypes.
24389273 we observed a synergistic interaction between annonacin exposure and the presence of the R406W-tau mutation, which resulted in reduced degradation, increased phosphorylation and redistribution of neuronal tau.
24389033 Axonal tau mRNA is associated with granules distributed throughout the axon, including the growth cone. Tau mRNA-containing axonal particles are associated with elongation factor 1A.
24387985 Its mutation is rare cause of frontotemporal dementia in Korean population.
24375821 This study demonstrated that leukocyte and brain DNA methylation suggest that hypermethylation of the MAPT promoter is neuroprotective by reducing MAPT expression, which could be modified by vitamin E in a haplotype-specific manner.
24372973 not find evidence for association of MAPT H1 haplotype with essential tremor in studied population.
24364857 The acidic fragment of human Abeta (Abeta1-11) and a phosphorylated fragment of beta-Casein induced tau fibrillization in vitro.
24337498 Neuropathological characterization of two siblings carrying the MAPT S305S mutation demonstrates features resembling argyrophilic grain disease.
24278327 Tau likely induces spine loss in a calcium-independent manner.
24278307 The APP/PS1/htau mice displayed mild, age-dependent, Amyloid beta plaques and tau hyperphosphorylation, thus successfully recapitulating the late-onset Alzheimer's disease pathological hallmarks.
24270207 Tau phosphorylation is accelerated in the brains of Alzheimer's disease patients who also have psychosis.
24268747 The study indicates that serum tau protein levels measured on postnatal days 3 and 7 can predict neurological prognosis following neonatal asphyxia.
24268156 interplay between velocity and travel distance of Kinesin-based transport in the presence of Tau
24256615 The stabilities of Tau protein domains hints at mechanistic differences in the aggregation pathways.
24253235 The results of this study indicate that MAPT haplotypes influence motor features in PD by showing that H1/H1 PD patients are significantly more likely to present a NTD clinical phenotype characterized by widespread pathological degeneration
24251416 The binding of Tau to MTs provides support for a model in which Tau's hot spots of MT interaction bind independently of each other and are differentially affected by phosphorylation.
24235150 Data indicate that fibrils consisting of endogenous and exogenous Tau are released from cells and their potential to spread Tau pathology.
24225352 Pulse pressure elevation is associated with increased cerebrospinal fluid (CSF)levels of phosphorylated-tau in cognitively normal older adults.
24218087 mutated human tau expressed in mouse is associated with chromosome instability
24212387 Abnormal cerebrospinal fluid biomarker values for phosphorylated-tau protein predict more rapidly changing dementia scores in Alzheimer's disease patients.
24163366 Tau antibody uptake is primarily receptor-mediated, these antibodies are mainly found in neurons with Tau aggregates, and their intracellular interaction leads to clearance of Tau pathology.
24150109 study identified 3 tau mutations (4R P301L, 4R deltaN296, and 4R R406W) that reduce kinesin translocation velocity along microtubules relative to WT tau; data provide support for the notion that aberrant modulation of kinesin translocation is a component of tau-mediated neuronal cell death and dementia
24146816 Expression of Tau40 induces activation of cultured rat microglial cells suggesting a novel role for human Tau40.
24121548 A novel mutation in MAPT exon 13 (p.N410H) causes corticobasal degeneration.
24116116 Results indicate that tau in cerebral spinal fluid (CSF) occurs as a series of fragments and that discrimination of Alzheimer's disease from control is dependent on the subset of tau species measured.
24101602 Altered CpG methylation in sporadic Alzheimer's disease is associated with MAPT dysregulation.
24098548 Protein disulfide isomerase interacts with tau protein and inhibits its fibrillization.
24089520 Two novel Tau antibodies targeting the 396/404 region are primarily taken up by neurons and reduce Tau protein pathology.
24086739 A novel MAPT mutation, G55R, in a frontotemporal dementia patient leads to altered Tau function.
24085246 Patients with Alzheimer disease had higher levels of CSF tau and phosphorylated-tau than healthy controls and non-AD demented controls.
24081456 The rate of MAPT mutation-positive FTLD in this series was 15.4%. Categories designating the risk level for hereditary cause were termed high, medium, low, apparent sporadic, and unknown significance.
24076336 REVIEW: role for tau at the synapse in Alzheimer's disease pathogenesis
24076100 Performed a detailed analysis of tau misprocessing in a new transgenic mouse model combining APP, PS1 and tau mutations.
24072703 Structural determinants of Tau aggregation inhibitor potency.
24069608 Altered MAP2 and tau expression in mesial temporal lobe epilepsy (MTLE) and decreased tau expression in MTLE with psychosis were found.
24063855 Increase in mRNA levels of the TAU gene is associated with Alzheimer's disease.
24050961 REVIEW: research on cell-to-cell propagation of tau pathology, believed to be central to disease progression; and discussion of tau immunotherapy in the light of these findings
24041972 evaluation of the genetic contribution of MAPT variations to the pathogenesis of frontotemporal dementia(FTD) and determined the frequency distribution of MAPT haplotypes in FTD, other dementia groups and controls; study reports the absence of pathogenic mutations in MAPT, in a south Indian FTD cohort
24037441 In Alzheimer's brain, down-regulation of the protein kinase A (PKA) pathway could lead to dysregulation of tau exon 10, contributing to tau pathogenesis.
24018212 is one of the major genes linked to frontotemporal lobar degeneration.
23999428 Age-associated increases in FKBP51 levels and its interaction with Hsp90 promote neurotoxic tau accumulation.
23962722 study describes a novel mechanism in which the acetylation of tau on KXGS motifs inhibits phosphorylation on this same motif and also prevents tau aggregation; also demonstrated KXGS motifs are hypoacetylated in patients with Alzheimer Disease
23959642 17q21 inversion arose within the modern human lineage. The data also indicate that archaic hominins that coexisted in Eurasia probably shared the same MAPT subhaplotype, and this can be found in almost 2% of chromosomes from European ancestry.
23951348 The results demonstrate that in the interactions of Abeta and mutated tau oligomers, polymorphic mutated tau-Abeta17-42 oligomeric complexes were observed.
23951236 GSK3B and MAPT polymorphisms are associated with grey matter and intracranial volume in healthy individuals.
23948940 Insoluble human tau isolated from transgenic rats is able to infect cortical neurons in the area of injection.
23948919 A heterozygous guanine to cytosine mutation at the first base of codon 389 in MAPT is identified in a case of juvenile frontotemporal dementia with parkinsonism.
23948915 Tau hyperphosphorylation by DAPK1 renders brain cells more resistant to kinase-induced apoptotic cell death.
23948912 In transgenic mice with tau mutations, spatial memory is impaired at 9 months of age but non-spatial memory as early as 6 months.
23948904 Dyrk1A enhances tau expression by stabilizing its mRNA.
23948901 Expression of human tau protein in Drosophila melanogaster induces behavioral motor and olfactory learning deficits.
23948900 Transgenic mice expressing 3-fold higher human tau display normal and fast axonal transport rates.
23948895 Different forms of tau aggregates are involved in the different pathological changes that occur in tauopathies.
23943618 alterations in the membrane localization of PP2A and Tau following down-regulation of LCMT1 may lead to PP2A and Tau dysfunction in AD.
23911736 These results suggest that MAPT rs1052553 polymorphism is not related with the risk for relapsing bout onset MS.
23900411 50% of patients with Parkinson disease also develop sufficient numbers of amyloid-beta plaques and tau-containing neurofibrillary tangles for a secondary diagnosis of Alzheimer's disease.
23827424 Total tau protein in CSF is an accurate diagnostic biomarker for brain injuries in children.
23824268 Amyloid beta may be released from axons of abnormal tau brainstem neurons in Alzheimer's disease.
23798682 GSK3alpha, GSK3beta, and MAPK13 were found to be the most active tau kinases, phosphorylating tau at all four epitopes.
23798570 Exogenous progestorone (9300-93,000 pg/ml) had a significant effect on overall Tau and nuclear TDP-43 levels, reducing total Tau levels by approximately 1.5-fold and increasing nuclear TDP-43 by 1.7- to 2.0-fold.
23794287 Loss of presenilin (PS)1 function propagates tau accumulation through impairment of cargo-receptor protein p62-dependent tau degradation.
23789343 Intensive protein synthesis in neurons and phosphorylation of beta-amyloid precursor protein and tau-protein are triggering factors of neuronal amyloidosis and Alzheimer's disease
23727081 Further evidence that specific variations in MAPT (rs3785883) and PPP3R1 (rs1868402) are associated with accelerated progression of Alzheimer's disease
23721814 The results indicate that the tauV337M mutation in mice disrupts, selectively, a subset of processes related to executive function.
23717682 levels of Tau-A showed an inverse correlation to cognitive function, which could indicate that this marker is a serum marker with pathological relevance for AD
23715095 The presence of phosphorylated-tau is likely to be involved in the changes to dendritic spines and the loss of synapses that leads to cognitive decline in Alzheimer's disease.
23684085 [review] The prevention of tau aggregation and propagation is the focus of attempts to develop mechanism-based treatments for tauopathies.
23681778 Negative Tau protein expression may be an effective predictor for taxane-containing neoadjuvant chemotherap.
23666762 Tau phosphorylation at Ser(2)(2) is mediated by MARK4. MARK4-tau interactions are of functional importance in the progression of Alzheimer disease.
23666174 Intermediate phosphorylated tau-181 cerebrospinal fluid levels are included with amyloid beta-peptide ratios in the differential diagnosis of Alzheimer's disease and dementia.
23664753 Its heterozygous variation causes Parkinsonism. (review)
23659998 Tau could induce conformational changes of microtubules, favoring recovery of microtubule self-assembly.
23640887 Involvement of brain acidosis in the etiopathogenesis of Alzheimer disease, and the asparaginyl endopeptidase-I2(PP2A)-protein phosphatase 2A-Tau hyperphosphorylation pathway.
23631819 Negative tau protein seems to be both good prognostic factor and a predictor of response to paclitaxel/platinum-based chemotherapy in EOC patients.
23624859 Here, authors report that mammalian tau proteins possess intrinsic enzymatic activity capable of catalyzing self-acetylation.
23621301 Contribution of dyslipidemia and cholesterol metabolism towards tau pathology during obesity is an interesting avenue to follow.
23597931 The CSF biomarker tau is important and useful as part of the diagnostic procedure for detecting AD and other dementia in elderly patients displaying psychotic symptoms.
23585566 Mammalian target of rapamycin (mTor) mediates tau protein dyshomeostasis: implication for Alzheimer disease
23585562 tau is a good substrate for PSK1 and PSK2 phosphorylation with mass spectrometric analysis of phosphorylated tau revealing more than 40 tau residues as targets of these kinases.
23576620 Cerebrospinal fluid Tau biomarker signals underlying Alzheimer disease pathology at least several years before the appearance of dementia symptoms.
23566348 Phosphorylated tau levels in cerebrospinal fluid (CSF) from Alzheimer's disease patients correlate with elevated BACE1 levels.
23562579 Prolyl oligopeptidase colocalizes with alpha-synuclein, beta-amyloid, tau protein and astroglia in the post-mortem brain samples with Parkinson's and Alzheimer's diseases
23554879 PINCH is increased and binds to hp-Tau. These studies address a new mechanism by which AD and HIV may intersect and identify PINCH as a contributing factor to the accumulation of hyperphosphorylated Tau.
23528367 [review] Soluble forms of both amyloid beta and tau protein act at the synapse to cause neural network dysfunction, and that these two pathological proteins may act in concert to cause synaptic pathology.
23518664 Sequence variant MAPT p.A152T is associated with a variety of frontotemporal dementia spectrum disorders and is identified in patients with clinical Alzheimer's disease.
23515417 A mutant associated with a K280 deletion (a mutation that causes a heritable form of neurodegeneration/dementia in the context of full length TAU) is seen to aggregate more readily than its wild-type counterpart.
23507417 This results are consistent with a recently published study that also did not find significant interactions of either smoking or caffeine intake with SNPs in SNCA, MAPT, or LRRK2 genes.
23499461 These data support a causative link between the phosphorylation and conformational state of tau, microtubuli-based transport, and the vulnerability of human neurons to oxidative stress.
23487739 From a genetic screen, we found that a histone deacetylase 6 (HDAC6) null mutation rescued tau-induced MT defects in both muscles and neurons.
23479202 Cerebrospinal fluid Abeta trimers are elevated in individuals at risk for Alzheimer disease and show stronger relationships with tau than does Abeta1-42, a surrogate for Abeta fibril deposition.
23475817 frontotemporal lobar degeneration patients with tau inclusions appear to have relatively greater white matter disease at autopsy than those patients with TDP-43
23475578 Tau overexpression is significantly associated with lower Gleason score in prostate cancer patients.
23458258 Studies indicate residue-specific information about amyloid intermediate states of IAPP, alpha-synuclein, and tau were characerized with Forster resonance energy transfer (FRET).
23446558 Used immunohistochemical methods to study Tau protein expression levels in gastric cancer specimens; used Western blot to detect the level of Tau protein expression in gastric cancer cell lines and to check the efficacy of paclitaxel in vitro application.
23443659 Aminothienopyridazines and methylene blue affect Tau fibrillization via cysteine oxidation.
23423488 DNA methylation, dysregulation of miR- 34c-5p, and MAPT expression are critical factors in the chemoresistance of gastric cancer to paclitaxel
23418567 Data indicate that double transgenic (Tg-FDD-Tau) mice showed a significant decrease in synaptophysin levels.
23396350 yeast studies have provided major new insights into the effects of tau and Abeta and, at the same time, offered new approaches to rapidly search for chemicals that may be involved in prevention of Alzheimer's disease--{REVIEW}
23362255 Isomerase Pin1 stimulates dephosphorylation of tau protein at cyclin-dependent kinase (Cdk5)-dependent Alzheimer phosphorylation sites
23358800 It involved in the same cascade of the malignant progression of gliomas.
23340677 The consequences of tau hyperphosphorylation on both neuronal and astrocytic metabolism and amino-acid neurotransmitter homeostasis were assessed in transgenic mice expressing the pathogenic mutation P301L in the human tau gene.
23338682 C9orf72-associated frontotemporal lobar degeneration patients present with early-onset behavioral variant with disinhibition compared to MAPT mutation carriers.
23332172 Reduction of tau phosphorylation in the brain is modulated by 5-lipoxygenase.
23332171 Tau ablation in knockout mice does not impair cognition and causes only minor motor deficits that are much more subtle than those associated with the aging process.
23317568 Our results suggest that MAPT, PGRN and APOE play limited roles in frontotemporal lobar degeneration pathogenesis among Indians
23276384 A novel ketone ester can ameliorate proteopathic and behavioral deficits in a transgenic Alzheimer disease model.
23269837 Tau fibrils showed a approximately 16-nm-thick fuzzy coat that resembles a two-layered polyelectrolyte brush, which is formed by the unstructured short C-terminal and long N-terminal domains. Mechanical and adhesive properties of the fuzzy coat are modulated by pH.
23264626 Curcumin suppresses soluble tau dimers and corrects molecular chaperone, synaptic, and behavioral deficits
23254634 Tau cleavage in diabetic conditions (especially in type 2 diabetes) may be a key link for the increased incidence of Alzheimer's disease in diabetic patients.
23247080 This study demonistration that THY-Tau22 mice that resemble behavioral and psychological signs and symptoms of dementia.
23237806 These results suggest that ER stress increases total tau protein and its mechanism is due to the decrease in the binding between tau and CHIP, which delays the degradation of tau protein through the ubiquitin-proteasome pathway.
23234879 Aggregates of hyperphosphorylated tau are visibly linked to the degree of cognitive impairment in Alzheimer's disease in these first human brain images.
23225000 Various aspects of structure and biochemistry of tau, fibril formation and clinical perspectives, including therapeutic strategies are reviewed in this chapter
23190742 HIV-1 Tat induces hyperphosphorylation of Tau in neuronal cells
23160422 Overview of development of abnormal tau in brainstem nuclei in the development and progression of Alzheimer disease. [Review Article]
23157676 Pin1 accelerates cis to trans conversion to prevent the accumulation of the pathogenic cis p-tau conformation in AD, providing the first structural evidence for how Pin1 protects against AD.
23154429 Chemo- and radiotherapy used in acute lymphoblastic leukemia (ALL) can influence future brain functioning. In a prospective study we analysed the cognitive functions of ALL survivors in relation to Tau protein as a marker of white matter injury.
23129775 Our data integrate Tau protein into the class of amyloidogenic proteins and enforce the hypothesis of a common toxicity-mediating mechanism for amyloidogenic proteins.
23121543 Agraphia associated with FTDP-17 is very heterogeneous.
23114515 Although pan-neuronal tau expression augments induction of hsp70 following heat shock, several HSP inducing compounds induce hsp70 protein in mammalian cells in vitro but do not detectably induce hsp70 mRNA or protein in tau expressing Drosophila larvae.
23105105 This study demonstrates that cells actively release Tau in the absence of disease or toxicity, and Tau release is modified by changes in the Tau protein that are associated with tauopathies.
23087208 Data suggest that the microtubule (MT)-induced Tau filaments provide a model for Alzheimer's studies.
23085090 In conditions of increased or altered expression of tau and its isoforms, a therapy that is not directly affected by changes in tau is desirable.
23064258 Mild cognitive impairment subjects carrying both APOE epsilon4 and MAPT-H1 variants showed gray matter atrophy that could be due to changes in MAPT expression.
23053136 we report mixed tau and TDP-43 pathology in a woman with behavioural variant frontotemporal lobar degeneration who had the C9ORF72 mutation, and the p.Ala239Thr variant in MAPT gene not previously associated with tau pathology
23047372 A role revealed for tau in genome and chromosome stability is ascribed to its function as a microtubule-associated protein as well as a protein protecting chromatin integrity through interaction with DNA.
23043292 The FTDP-17 mutants had very different effects on the aggregation and microtubule interactions of tau.
23041958 Overview of the role of tau protein in Alzheimer disease pathogenesis. [Review Article]
23036273 Hippocampal injection of IgG triggers underlying changes in tau phosphorylation, amyloidbeta deposition, tau-related protein kinase GSK-3beta and AKT in the brains of transgenic db/db diabetic mice.
23034520 The disparity between total-tau levels encountered in Alzheimer's disease and other neurodegenerative conditions is not due to differential recognition of tau assembly forms or the extent of degeneration.
23028730 The mechanism of cell death induced by APP and its c-terminal fragments and tau was investigated.
23019339 Tau protein diffuses along the microtubule lattice
23012332 Compared with Alzheimer's disease, elevated tau or reduced amyloid-beta1-42 are usually not found in other forms of neurodegenerative dementia.
23001634 The results of the present study suggest that the SNP rs1052553 in MAPT is not related with the risk for restless legs syndrome
22984603 Data indicate that transgenic tau P301S neonatal slices displayed a constant high vitality level, while the vitality of adult slice cultures decreased significantly upon cultivation.
22976542 tau protein expression correlated with breast cancer sensitivity to taxanes-based neoadjuvant chemotherapy; patients negative for tau expression were more likely to achieve pathological complete response.
22975846 AMPH1 protein level is reduced in brain regions known to accumulate aggregates of hyperphosphorylated tau proteins.
22952452 These results suggest that an increase in tau phosphorylation at Ser262 through PAR-1 contributes to tau-mediated neurodegeneration under a pathological condition in which axonal mitochondria is depleted
22941973 Under reducing condition, the Tris-buffer fraction of transgenic tau demonstrates by western blotting to contain both 50-60 kDa normally-sized and 64 kDa tau. Both are thermo-stable, but the 64 kDa tau shows a higher degree of phosphorylation.
22940644 Overall, a model is emerging whereby subtle alterations in MAPT splicing, driven by genetic variation, gradually increases an individual's risk of disease
22936006 We showed that pathogenic forms of tau are degraded via the proteasome.
22927204 These results suggest that rs7768046 and rs913275 both influence CSF tau levels in an Alzheimer's disease-associated manner.
22911817 The MAPT H1 rs1052553 is not associated with the risk for developing familial essential tremor in the Spanish population.
22910909 Hyperphosphorylation of Tau induced by naturally secreted amyloid-beta at nanomolar concentrations is modulated by insulin-dependent Akt-GSK3beta signaling pathway.
22867711 Synaptic hyperphosphorylated tau oligomers may be an important mediator of the proteotoxicity that disrupts synapses in Alzheimer's disease.
22862741 Changes in cerebrospinal fluid isoforms reflect the pathological changes in tau isoform homeostasis in the degenerative brain that are relevant for differential clinical diagnosis.
22862303 Solid-state nuclear magnetic resonance study demonstrates beta-sheet core of Tau paired helical filaments.
22853691 Adults with ALS from a small Chinese Han pedigree had mutations of risk regions in 3',5' UTR, and in introns 9, 10, 11, 12. One single nucleotide polymorphism of A to G at 138278 at 3' UTR of the gene was over-expressed in fALS.
22833681 tau interacts in a phosphorylation-dependent manner with the PSD95-Fyn-NMDA receptor complex at the postsynaptic site
22819391 H1 haplotype is associated with increased SNCA deposition in Lewy body dementia.
22802095 These results support the hypothesis that haplotype-specific variation in the MAPT 3' UTR underlies an Abeta-independent mechanism for neurodegeneration in tangle-predominant dementia.
22797329 combination of the V337M and R406W mutations of tau accelerates human tau phosphorylation and induces tau pathology as well as cognitive deficits.
22767602 Phosphorylation of SRp55 by Dyrk1A suppressed its ability to promote Tau exon 10 inclusion.
22764226 These findings reveal a novel mechanism involving methylation-dependent pathways in L-dopa induces PP2A hypomethylation and increases Tau phosphorylation, which may be potentially detrimental to neuronal cells.
22723018 Genetic risk factors for neurodegenerative diseases at the MAPT locus are likely to operate by changing mRNA splicing in different brain regions, as opposed to the overall expression of the MAPT gene.
22701727 Fibril-forming motifs play a key role in the fibrillization of human Tau protein and could be the determinants of amyloidogenic proteins tending to misfold.
22699846 A P332S mutation changes the PGGG motif of the third repeat domain of tau, reducing the ability of tau to bind microtubule. From a clinical point of view, this mutation is associated with considerable intrafamilial phenotypic variation.
22677170 Cyclic AMP-dependent protein kinase regulates 9G8-mediated alternative splicing of tau exon 10
22668776 We demonstrate that tau secretion and its suppression by low temperature also occurs in human neurons
22659094 On the basis of the aggregation behaviours of a series of MBD and full-length tau mutants, a possible self-association model of tau is proposed and the relationship between the aggregation form and the association pathway is discussed.
22648764 CSF Abeta and CSF tau were observed to have independent effects on neuroimaging and CSF tau had a direct effect on baseline cognition independent of brain structure and function.
22637478 is the dominant stimulus for Tau phosphorylation. Hence, ExoY is a promiscuous cyclase and edema factor that uses cAMP and, to some extent, cGMP to induce the hyperphosphorylation and insolubility of endothelial Tau.
22615831 Phosphorylation and cleavage of tau favored its secretion by Hela cells.
22613722 Monoubiquitination promotes calpain cleavage of the protein phosphatase 2A (PP2A) regulatory subunit alpha4, altering PP2A stability and microtubule-associated protein phosphorylation.
22595621 In the analysis of both the Parkinson's group (PD) and related dementia subgroup and the entire PD sample, significant negative cerebrospinal fluid-grey matter volume correlations for tau and phospho-tau are found.
22595371 This study suggested that the A152T variant is a risk factor associated with the development of atypical neurodegenerative conditions with abnormal tau accumulation.
22561167 Authors discuss the qualifications of tau protein as a possible "prionoid" mediator of lesion spread based on recent characterizations of the secretion, uptake and transneuronal transfer of human tau isoforms in a variety of tauopathy models, and in human patients. [Review]
22556362 the first genetic evidence and functional studies supporting the role of MAPT p.A152T as a rare risk factor for both FTD-s and Alzheimer's disease
22539343 aggregation propensity correlated with genetic risk reported for multiple tauopathies, implicating aggregation as one candidate mechanism rationalizing the correlation between Tau expression patterns and disease.
22535953 human HTRA1 degrades aggregated and fibrillar tau, a protein that is critically involved in various neurological disorders
22532069 Tau-induced impairments are reversible after switching-OFF pro-aggregant Tau in mice expressing pro-aggregant full-length human Tau.
22530600 Amyloidbeta42, total-tau(181), and phosphorylated-tau present a gradient of cerebrospinal fluid (CSF) concentrations between healthy elderly controls, depressed, and patients with Alzheimer's disease.
22521809 Binding of the three-repeat domain of tau to phospholipid membranes induces an aggregated-like state of the protein
22496370 Paired helical filaments from Alzheimer disease brain induce intracellular accumulation of Tau protein in aggresomes.
22492994 evidence that CHIP binds, ubiquitinates and regulates expression of histone deacetylase 6 (HDAC6); demonstrated HDAC6 levels correlate with tau burden, while a decrease in HDAC6 activity or expression promotes tau clearance; evidence that loss of HDAC6 activity augments the efficacy of an Hsp90 inhibitor and drives degradation of tau
22490326 A cerebrospinal fluid model transforms values for tau and amyloid beta(1-42) detected by the xMAP platform, showing that patients with autopsy-confirmed Alzheimer's and frontotemporal lobar degeneration are differentiated with high sensitivity.
22464332 Study provides direct evidence that Pin1 accelerates cis-to-trans conversion, preventing pathogenic cis p-tau accumulation and tau pathology in Alzheimer's disease.
22461630 Trans-cellular propagation of Tau aggregation by fibrillar species.
22460328 data suggest an essential role of Bip in GSK-3beta dependent tau hyperphosphorylation in endoplasmic reticulum stress by promoting the binding of GSK-3beta to tau
22419736 Data indicate that the neuronal adenylate kinase-1 (AK1) is induced by Abeta(42) to increase abnormal tau phosphorylation via AMPK-GSK3beta and contributes to tau-mediated neurodegeneration.
22406198 Three proteins, ATP synthase, Adenosine kinase and Regucalcin showed significantly decreased levels in the plasma of tau transgenic mouse, which was further confirmed by Western blotting
22403409 The protein phosphatase PP2A/Balpha binds to the microtubule-associated proteins Tau and MAP2 at a motif also recognized by the kinase Fyn.
22401494 hTau40s strong interaction with anionic lipids induces tau structural compaction and membrane disruption
22396417 Overexpression of wild-type Tau or mutated forms in which these sites had been changed to either unphosphorylatable alanines or phosphomimetic aspartates inhibits mitochondrial movement in the neurite processes of PC12 cells.
22367970 Abnormal interaction between the mitochondrial fission protein Drp1 and hyperphosphorylated tau in Alzheimer's disease neurons
22366796 Acetylation of tau at lysine 280 is a pathological modification that may contribute to tau-mediated neurodegeneration by both augmenting losses of normal tau properties
22366795 Patterns of atrophy therefore differed across subjects with C9ORF72, tau and progranulin mutations and sporadic frontotemporal dementia
22359235 Low stathmin and high MAP-tau are associated with increased microtubule stability and better prognosis in breast cancer.
22344634 The results of this study did not find a significant association between MAPT haplotype and rates of cognitive decline.
22343013 Moreover, the levels of DnaJA1 and Hsp70 seem to play against each other with regard to tau: as DnaJA1 levels increase, tau levels are reduced, but this can be prevented if Hsp70 levels are simultaneously induced.
22337826 The tau protein isoform with three microtubule binding domains (3R-Tau)is a marker of new axons generated from the subgranular zone in the hippocampal dentate gyrus.
22312444 generation of a transgenic mouse model that differentially expresses pathological human tau in the entorhinal cortex, and examination of the distribution of tau pathology at different timepoints
22310385 Transfection of a series of MAPT promoter deletions revealed unique functional domains. The distal-most had different activities in neuronal vs. non-neuronal cells
22304362 Positional effects of phosphorylation on the stability and morphology of tau-related amyloid fibrils
22303461 LRRK2 plays an important role as a physiological regulator for phosphorylation-mediated dissociation of tau from microtubules.
22294156 results show that human tau protein may alter the GCs-mediated regulation of PKA activity and CREB phosphorylation
22291217 There was evidence of an association between the MAPT H1 haplotype (rs1052553 A-allele) and Alzheimer's type pathology (table 2), with and without adjustment for age, sex and APOE genotype.
22291015 Intramolecular disulfide bonds retard tau aggregation by stabilizing conformations that lack beta-strand content in subsequences that are aggregation-prone.
22272245 Data suggest that KLC1 is required for normal neural differentiation, ensuring proper metabolism of AD-associated molecules APP and Tau and for proliferation of neural precursors (NPs).
22269004 analysis of how Abeta toxicity and tau are physiologically connected, and how membrane trafficking may play an important role in the pathogenesis of Alzheimer's disease [review]
22236337 Data indicate that Hsp70/HSPA1A inhibits aggregation of tau in isoform-specific fashion (especially 3R/4R [repeat/alternative splicing] forms) while having little impact on tau isoforms to mediate microtubule assembly.
22235112 Increased Tau phosphorylation by GABA(A) receptor activity was associated with reduced Tau binding to protein phosphatase 2A and was dependent on Cdk5 but not GSK3beta kinase activity.
22233767 FTDP expression level is abnormally low in frontal cortex of Alzheimer's disease compared to controls.
22232001 In differentiated neuronal A1 cells, the overexpression of Amyloid-beta protein precursor modulates tau phosphorylation, altering the ratio between cytoskeletal and nuclear pools, and correlates with cell death.
22229117 Review of the role of tau in Alzheimer disease and potentinal targeted therapies.
22221882 This study showed that the MAPT association with pathologically proven parkinson disease and strongest risk factor for progressive supranuclear palsy.
22214313 The presence of widespread astrocytic tau pathology suggests that ALS with cognitive impairment may initially be characterized by astrocytic pathology.
22213792 Low cerebrospinal fluid (CSF) levels of total-tau and phosphorylated-tau in clinic patients with mild cogntive impairment (MCI) predict conversion from mild cognitive impairment (MCI) to Alzheimer dementia
22193445 Inhibition of PARP-1 could decrease tau phosphorylation in HEK293/tau441 cells probably through decreasing GSK-3 activity.
22177996 Despite specific tau pathology, tau gene transfer surprisingly does not cause obvious neuronal loss or behavioral impairment in rats.
22176350 The tau gene loci rs10675722 allele with short tandem repeats may increase the risk for Alzheimer disease and vascular dementia.
22174735 Tau-targeted immunization slows the progression of neurofibrillary tangles pathology in mice.
22170881 disposition of Abeta and tau is likely important in both LRRK2-related and sporadic Parkinson disease, even during early phases of the disease
22159117 This study concluded that mutant protein Tau modulates cognition and morphology of spines similarly and in both directions, with pathology later in life coinciding with increased phosphorylation and relocalization of Tau from axons to soma and processes.
22127750 The study denomistrated that Genetic screening identified patients bearing MAPT mutaton but still the majority of FTLD cases with an inherited familial trait are negative to genetic analyses.
22116524 Tangle evolution linked to differential 3- and 4-repeat tau isoform deposition: a double immunofluorolabeling study using two monoclonal antibodies.
22109955 This study provides a prospective detailed clinical picture a family with PSP-like syndrome. It shows that G303V mutation in exon 10 of the tau gene can be responsible for PSP-like features with an autosomal dominant pattern of transmission.
22104010 Our findings strongly confirm SNCA and MAPT as major Parkinson disease susceptibility genes
22102449 Unfolded protein response activation is intimately connected with the accumulation and aggregation of p-tau in the hippocampus of tauopathies.
22085312 Data suggest that sequences throughout tau (in addition to PHF6/PHF6*) can seed amyloid formation or affect aggregation kinetics/thermodynamics.
22072628 Phosphorylation in the proline-rich region of the disordered Tau protein strongly decrease the capacity of Tau to polymerize tubulin into microtubules.
22057275 exosome-mediated secretion of phosphorylated tau may play a significant role in the abnormal processing of tau and in the genesis of elevated CSF tau in early AD.
22039833 Addition of Hsp70 to a mixture of oligomeric and fibrillar tau aggregates prevents the toxic effect of these tau species on fast axonal transport.
22039514 pathological synergistic effect between tau and alpha-syn may amplify the deleterious process and spread the damage in neurodegenerative diseases that show co-occurrence of both pathologies
22027014 The results of this study demonistrated that common variants at AbetaPP, PSEN1, and PSEN2 and MAPT are unlikely to make strong contributions to susceptibility for late onset Alzheimer's disease.
22022446 The vocalization disorder of old Tau.P301L mice could be, at least in part, reminiscent of language disorders of elderly suffering tauopathy.
22002658 Data indicate that Abeta-associated volume loss occurs only in the presence of phospho-tau in humans at risk for dementia.
22002427 This study demonistrated that 2 transgenic mouse models for tauopathy in which approximately endogenous levels expressed E391-truncated human tau are sufficient to initiate early stages of tau pathology.
21983102 VCP may be involved in regulating post-translational processing of tau in Alzheimer's disease
21980472 independent relationship between amyloid-beta and tau in controlled cortical impact model (CCI) of traumatic brain injury
21978388 Properties of the monomeric form of 14-3-3zeta protein and its interaction with tau and HspB6. This interaction requires phosphorylation of tau protein and HspB6.
21976528 Hypothalamic-pituitary-adrenal axis dysregulation in Alzheimer's disease neuropathogenesis suggests that prolonged stress may increase Abeta and tau hyperphosphorylation.
21969238 Suggest possible role for tau protein as a prognostic factor to predict progression from optic neuritis to multiple sclerosis.
21966400 Fibrillization of human tau is accelerated by exposure to lead via interaction with His-330 and His-362
21949350 These findings suggest therapeutic targets other than mitigation of tau phosphorylation.
21945393 Tau(wt) and Tau(P301L) alter kinase activities, but they differentially induce inflammation, Tau modification and alpha-Synuclein phosphorylation.
21943955 The results of this study indicated that the P364S mutation enhances the fibrillogenic properties of tau protein.
21942206 Hyperphosphorylation of tau isoforms can play a major role in determining the isoform composition of microtubule-associated protein tau aggregates in disease.
21934724 Axonal leakage-a novel type of axonopathy, was usually accompanied with the extensive swollen axons and varicosities, and was associated with the origin and development of beta-amyloid plaques and hyperphosphorylated tau in the brains of Alzheimer patients.
21934536 Zinc induces S214 phosphorylation in tau through zinc induces S214 phosphorylation in tau through extracellular signal-regulated kinase (ERK) activation and interferes with microtubule polymerization.
21931162 the kinetic roles of the inducer heparin and of rod-like protofibrils during amyloid fibril formation by Tau protein
21919991 Ubiquitin targeting of tau protein occurs at neurofibrillary tangles in the early and intermediate maturation stages.
21911695 In individuals with normal cognition and higher levels of cerebrospinal fluid tau and phosphorylated tau at baseline, time to incident cognitive impairment is moderated by education and brain volume as predicted by the cognitive/brain reserve hypothesis.
21910444 A large number of distance restraints obtained from NMR paramagnetic relaxation enhancement in combination with ensemble conformer calculations demonstrate that pseudophosphorylation causes an opening of the transient folding of Tau.
21907761 We observed an early neurodegenerative effect of this altered tau protein that was characterized by a specific decrease in neurogenesis in the ventral dentate gyrus.
21898123 Possible interactions between genetic factors in the MAPT region and the leucine-rich repeat kinase (LRKK)2 gene influence the clinical course of Parkinson disease patients.
21888627 Quantitative measurement of tau expression has prognostic value in breast cancer patients: with high expression associated with longer median time to tumor progression
21881826 Data reveal a new player in tau exon 10 alternative splicing regulation and uncover a previously unknown mechanism of PSF in regulating tau pre-mRNA splicing.
21860087 Hyperphosphorylated tau and total tau levels in cerebrospinal fluid best represent the cortical profile of patients with vascular dementia compared to those with Alzheimer's disease. the best.
21860086 End-stage Abeta and tau pathologies in triple transgenic Alzheimer's disease (AD) model mice are informative in assessing co-evolving amyloid beta and tau pathologies.
21854751 Soluble tau plays an important role in mitochondrial abnormalities, which likely contribute to neuronal dysfunction in Alzheimer's disease.
21849646 Functional connectivity in the default mode network is altered in MAPT subjects before the occurrence of both atrophy and clinical symptoms in behavioral variant frontotemporal dementia.
21846727 E46K human alpha-synuclein transgenic mice develop Lewy-like and tau pathology associated with age-dependent, detrimental motor impairment
21841253 Overexpression of the longest human tau isoform in cultured primary cortical neurons has a strong impact on prion trafficking, inducing a marked down-regulation of the cell-surface bound PrPC.
21841250 Salivary tau species could be ideal biomarkers for Alzheimer's disease diagnosis; the phosphorylated tau/tau ratio significantly increases in Alzheimer patients.
21839061 Neuroinflammation participates essentially in tau-mediated neurodegeneration.
21825215 Within each Alzheimer clinical group the cerebrospinal fluid (CSF) Abeta42 marker level is abnormal more often than is the CSF total tau level or the adjusted hippocampal volume.
21822709 Results indicate a tight relationship between the amyloidogenic character of Tau and brain malfunction, and suggest that the cognitive impairment is caused by toxic human Tau(RD) species rather than by mouse Tau aggregates.
21816655 This study provides no statistically significant evidence of gene-gene interaction effects for SNCA, MAPT and LRRK2 genes for Parkinson's disease
21811019 Common genetic variation in the tau kinases pathway does underlie individual differences not only in susceptibility to Alzheimer's disease but also in disease phenotype (age at disease onset).
21807765 Changes in the miR-132/PTBP2 pathway could contribute to the abnormal splicing of tau exon 10 in the brain.
21763469 Although raphe tauopathy concerns mainly non-serotoninergic (5-HT) neurons, the 5-HT metabolism of terminal Tau.P301L transgenic mice is altered.
21763357 The binding of Tau stabilizes tubulin in a conformation less susceptible to oligomerization by PrP.
21755018 Upregulation of total tau expression (SFRS7-independent) and tau exon 10 splicing (SFRS7-dependent), as shown in this study to be both affected by STOX1A, is known to have implications in neurodegeneration.
21753175 Familial FTLD-TDP shows relatively more posterior hypoperfusion, possibly related to significant memory impairment. Patients with MAPT were characterized by impaired perfusion of the temporal regions and naming deficits.
21753165 Subjects with FTD with GRN mutations have a faster rate of whole brain atrophy than subjects with FTD with MAPT mutations, with similar rates of hippocampal atrophy.
21714002 Psychotic symptoms were not associated with the presence of any examined polymorphisms in the MAPT.
21705366 Hypophosphorylated Tau showed stronger neuronal toxicity compared to normal or pseudophosphorylated Tau.
21698260 assessment of sensorimotor gating could be used to detect the earliest manifestations of tauopathies exemplified by prodromal AD, in which abnormal tau protein may play critical roles in the onset of neuronal dysfunctions
21694458 These assays are suitable for analysis of CSF t-tau and p-tau181 in a single laboratory supporting multi-center Alzheimer's disease clinical trials
21692989 Pro216 in tau PXXP motif plays role in interaction of tau with Fyn-SH3; phosphorylation of tau at Tyr18 is important for mediating Fyn-SH2-tau interactions; tyrosine phosphorylation influences tau localization in cortical neurons which is Fyn-dependent
21685912 Variation in MAPT gene is associated with tauopathy progressive supranuclear palsy.
21677375 Unexpected discovery that in AD, there is conspicuous abnormal phosphorylation of the tau protein in a selective subset of dendritic spines.
21670401 This work demonstrates the previously unrealized visualization of neuropathological aggregates of beta-amyloid protein and tau levels in the living brains of a nondemented Down syndrome group.
21666499 This study demonstrated that overexpression of P301L tau causes marked impairments in Arc upregulation in response to environmental enrichment in both tangle-bearing and morphologically normal neurons.
21638028 MKK4 was identified as playing a key role in Tau-S422 phosphorylation in human neuroblastoma cells
21613474 This study of an exceptional cellular model of tau pathology also examines alpha-synuclein-induced tau inclusion formation and provides novel insights into hyperphosphorylation observed in disease.
21604267 [review] Aberrations in tau splicing regulation cause several neurodegenerative diseases, which lead directly to dementia.
21577325 Failure of proteasomal and non-proteasomal proteolytic clearance mechanisms leads to tau accumulation and progressive neurofibrillary degeneration in Alzheimer's disease.
21575385 The expression of tau-related protein is demonstrated in the spinal cord of Alzheimer's disease patients, suggesting that axonal transport defect may play a role in the pathogenesis of Alzheimer's disease.
21568901 has been demonstrated that MAPT mutations are causative of monogenic autosomal dominant progressive supranuclear palsy (PSP); in sporadic PSP, confirmed role of MAPT in increasing risk; H1 MAPT haplotype has been consistently associated with PSP[review]
21558644 MAPT mutation(g.123798G>A), leading to an amino acidic change(p.Gly304Ser) in the second MT binding domain, ina female patient diagnosed clinically with progressive nonfluent aphasia.
21555603 The ratios of total tau to amyloidbeta1-42 and p-tau181 to Abeta1-42 outperforms any single analyte, including Abeta1-42, in discriminating individuals with vs without cortical amyloid in a large cohort of research participants.
21555518 MAPT is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21550980 the existence of alternative Tau aggregates that precede formation of fibrillar Tau pathologies and raises the possibility that these hierarchical oligomeric forms of Tau may contribute to neurodegeneration.
21530001 Colocalization of human P-tau and AChE supports the conclusion that P-tau can act to increase AChE.
21510936 that phosphatidic acid, via the mTOR kinase, can trigger tau phosphorylation on a site known to reduce paired helical filament (PHF) formation.
21504133 Patients with mild cognitive impairment and low Abeta42 peptide fragment, with high tau levels in the cerebrospinal fluid, have a substantially increased risk of developing Alzheimer's disease, even after adjustment.
21504113 The concentration of tau in the cerebrospinal fluid markedly increased six months postoperatively following heart surgery; gradual cognitive decline is also present.
21498513 the conformation and aggregation of Tau are regulated through a complex balance of different intra- and intermolecular interactions.
21492964 Tau knock-in mice have age-dependent changes in axonal transport of mitochondria and increased locomotor activity in old age, resembling early consequences of tau dysfunction that eventually precipitates pathogenesis in humans.
21489990 Egr-1 is an in vivo regulator of tau phosphorylation and suggest that in AD brain increased levels of Egr-1 aberrantly activate an Egr-1/Cdk5/PP1 pathway, leading to accumulation of hyperphosphorylated tau, thus destabilizing the microtubule cytoskeleton.
21489655 CSF tau markers reflect the neuronal loss associated with the physiopathological process of Alzheimer's disease.
21482827 Abeta-mediated neuronal cell death involves the loss of full-length Tau and/or the generation of toxic fragments but does not involve or require hyperphosphorylation of full-length Tau.
21450370 Asp421-cleaved tau and Abeta cooperate to impair mitochondria, which likely contributes to neuronal dysfunction in Alzheimer disease.
21450369 Blockage of RAGE attenuates AGE-induced glycogen synthase kinase (GSK)-3 activation, tau hyperphosphorylation, and memory deficit with restoration of synaptic functions.
21442128 Results show high levels of the 17-kDa tau fragment and enhanced calpain activity in the temporal cortex of AD patients and in brain samples obtained from patients with other tauopathies.
21439371 observed an increased expression of CUGBP1 and ETR3-like factor 2 (CELF2) only in the brain of myotonic dystrophy type 1 patients with a mis-splicing of tau exon 10
21435449 CDK5 activation contributes to the neurodegenerative process in HIV encephalitis via abnormal tau phosphorylation
21425343 Single-nucleotide polymorphisms in MAPT (rs1800547; P = 3.1 x 10(-4) ) is significantly associated with Parkinson's disease
21403021 Our data confirm that MAPT H1 is associated with Parkinson disease and has a strong influence on the risk of dementia in Parkinson disease patients
21397051 Genetic variation in MAPT is unlikely to make a major contribution to the risk of blindness among Leber's hereditary optic neuropathy mutation carriers.
21391235 This study confirms the association between Parkin diseae and both SNCA SNPs and the H1 MAPT haplotype.
21388338 REVIEW: high CSF t-tau and p-tau concentrations reflect axonal and neuronal damage and injury, which correlates with a neurofibrillary tangle stage and load, also reflecting the intensity of the disease process
21368381 Tau protein is present in platelets; the platelet levels of this oligomeric protein could serve as a novel and reliable biological marker for Alzheimer's disease.
21367866 the Hsp90 kinase co-chaperone Cdc37 regulates tau stability and phosphorylation dynamics
21367856 down-regulation of PKA dysregulates the alternative splicing of tau exon 10 and contributes to neurofibrillary degeneration in Alzheimer disease by causing an imbalance in 3R-tau and 4R-tau expression
21348938 Studies indicate there is a growing awareness that tau is a central player in AD pathogenesis.
21344240 Mutation screening of MAPT identifies novel sequence variants using a bioinformatic approach; further studies are necessary to determine their possible functional consequences in South African patients with Parkinson's disease.
21343707 we report the finding of the V363I mutation of the microtubule-associated protein tau gene in a sporadic early onset frontotemporal dementia patient and in several members of her family
21343338 Using an RNA affinity pulldown-coupled mass spectrometry approach the study identified DDX5/RNA helicase p68 as an activator of TAU exon 10 splicing.
21342022 REVIEW on the core AD biomarkers, Abeta and phosphor-tau (p-tau), on different methods and modalities of assessing them [eg, cerebrospinal fluid analysis and PET imaging], and on their diagnostic and predictive value in preclinical and clinical stages of AD
21342021 REVIEW: compared to controls, tau concentrations are moderately elevated in dementia with Lewy Bodies, frontotemporal lobar degeneration, and vascular dementia, while p-tau concentrations are only slightly elevated in DLB and not elevated in FTLD and VaD
21340680 Data show that knockdown of histone deacetylase 6, a protein known to interact with tau, reveals a requirement for HDAC6 activity in tau aggresome formation.
21339331 A R406W mutation in TAU leads to impaired membrane binding.
21333649 Data show that SC35 stabilized tau mRNA by binding to the SC35-like element of exon 10.
21327254 Data identify Tau as potential substrates for the O-beta-N-acetylglucosaminyltransferase (OGT).
21325519 Tau(RD) mice are strongly impaired in memory and show pronounced loss of long-term potentiation (LTP), suggesting that Tau aggregation specifically perturbs these brain functions.
21321341 The MAPT H1 haplotype is not a risk factor for essential tremor and multiple system atrophy.
21320871 Elevation of NPEPPS activity blocks accumulation of hyperphosphorylated TAU protein and slows down the progression of Alzheimer's disease.
21288907 there are markedly different regulatory effects on microtubule assembly and dynamic instability of tau in its phosphorylation
21281813 Deletion of murine tau accelerated tau aggregation during aging of mutant tau transgenic model.
21276080 Tau accumulation is present in seizure-associated glioneuronal lesions associated with abnormal reconstitution of the cortex.
21243369 Protein interacting with NIMA (PIN1) changes are a constant feature of Alzheimer's disease pathology and could serve as a biomarker of the onset or spread of Alzheimer's disease neuropathology independent of tau or amyloid beta(Abeta) proteins.
21212533 This study found that GSK-3beta2 has lower phosphorylation activity to tau at than GSK-3beta1 in cells, whereas the two variants exhibit equivalent levels of phosphorylation activities to amyloid precursor protein.
21210655 Peroxynitrite-induced nitrative and oxidative modifications alter tau filament formation.
21181298 Data show that the novel gamma-secretase modulator CHF5074 can fully reverse beta-amyloid-associated tau pathology, thus representing a promising therapeutic agent for AD.
21176711 Unclassifiable tauopathy is associated with an A152T variation in MAPT exon 7.
21159074 In the Caucasian patient-control series examined, risk for Parkinson disease was influenced by variation in alpha-synuclein and tau proteins but not glycogen synthase kinase GSK3beta.
21157379 Overexpressed DYRK1A in Down syndrome (DS) may contribute to alternative splicing of exon 10, increased expression of 3-repeat tau, and early onset of neurofibrillary degeneration in DS.
21157033 In brain from Alzheimer's patients, protein phosphatase 2B (PP2B) activity correlated positively, rather than negatively, to the levels of tau phosphorylation at several sites that can be dephosphorylated by PP2B in vitro.
21135556 cerebrospinal fluid tau and p-tau levels were elevated in primary progressive aphasia as compared to frontotemporal dementia
21131359 a novel role for nuclear Tau as a key player in early stress response.
21127069 alpha-synuclein is an in vivo regulator of Tau protein phosphorylation at Ser(262)
21123557 Glial-specific expression of human tau in a genetically tractable Drosophila model of tauopathy decreases lifespan and results in age-dependent glial fibrillary tangle formation.
21098973 In frontotemporal lobar degeneration, cerebrospinal fluid tau levels are associated with increased neurodegeneration and poor outcome.
21098287 Data show that the antidiabetic drug metformin induces PP2A activity and reduces tau phosphorylation at PP2A-dependent epitopes in vitro and in vivo.
21085657 Results indicate that human embryonic stem cell-derived neurons express all 6 tau isoforms and are a good model in which to study tau physiology and pathology.
21081103 The 14-3-3 zeta mutation mimicking phosphorylation of Ser184 does not markedly affect interaction with tau protein and improves the interaction of 14-3-3 zeta with HspB6.
21073671 Prescence of of APOEepsilon4 allele and MAPT H2 haplotype in frontotemporal lobar degeneration had a significant influence on the expression of synaptophysin and SNAP-25
21073671 Observational study of gene-disease association. (HuGE Navigator)
21063069 These results provide further support for the role of MAPT in development of Parkinson disease.
21063069 Observational study of gene-disease association. (HuGE Navigator)
21062914 Although Tau overexpression has been reported to be a predictive marker of taxane resistance, it is not likely to be a direct mechanism of taxane resistance in breast cancer.
21062741 The C terminus of tubulin, a versatile partner for cationic molecules: binding of Tau, polyamines, and calcium.
21062361 These results indicate that tau-positive granules in glia are common findings in multiple system atrophy and that tau aggregation might be another pathway to neurodegeneration
21061060 These results suggest that tau phosphorylation and GSK-3beta activation may not be essential for adult subventricular zone neurogenesis.
21058943 Observational study of gene-disease association. (HuGE Navigator)
21054681 Single locus analysis showed that G/G SNCA and H1/H1 MAPT risk genotypes were over-represented in patients with Parkinson disease compared with controls
21044986 There is a genetic association between tau polymorphism and vascular dementia in the Chinese population.
21044986 Observational study of gene-disease association. (HuGE Navigator)
21044948 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20974297 incorporation of negative charge into the T212 site can directly promote tau filament formation at multiple steps in the aggregation pathway
20951764 The genetic association of rs242557 tau gene variant in Parkinson disease patients with dementia is only observed in individuals with low cerebrospinal fluid amyloid-beta protein levels.
20951764 Observational study of gene-disease association. (HuGE Navigator)
20930301 Our results suggest that both MAPT H1/H1 genotype and APOE epsilon4 allele lead to a more rapid progression to dementia among mild cognitive impairment subjects, probably mediating an increased rate of amyloid-beta and tau brain deposition.
20930301 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20927385 Inhibition of eIF4A reduced the synthesis of APP and tau.
20927324 Unfolded protein response can ameliorate the toxicity of tau in vivo.
20926667 Human presenilin 1 and tau play convergent roles in axonal transport and neuronal survival and function, implicating their misregulation as contributors to Alzheimer disease pathogenesis.
20921227 Three- and four-repeat Tau coassemble into heterogeneous filaments.
20921222 increasing concentrations of insoluble tau aggregates leads to the formation of fibrillar tau, which causes NFTs to form.
20881758 Chinese patients with probable CJD have similar increased levels of tau in the CSF as in Caucasian patients. Measurement of CSF tau will be another potential technique for antemortem CJD diagnosis.
20876472 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20862329 Genetic variants associated with cerebrospinal fluid ptau(181) levels may have a greater impact on rate of progression of Alzheimer's disease.
20847421 The CSF tau ratio, combined with midbrain-to-pons atrophy, have been evaluated as a sensitive biomarker for early identification of progressive supranuclear palsy.
20838929 Data show that exposure of postmitotic neurons to caffeine leads to changes in tau phosphorylation concomitantly with downregulation of Akt signaling.
20838030 Although rare, MAPT mutations should be considered when there is an autosomal dominant family history of a progressive supranuclear palsy syndrome, particularly of young onset and with prominent behavioural features.
20837363 This study demonistrated that ApoE4 might be involved in Alzheimer's disease pathology the MAPT H1 allele neither associates nor interacts through an epistasis with ApoE4 in the development of the disease.
20837363 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20837015 the C-Hcdots, three dots, centeredpi interaction between Ile308 and Tyr310 is the elemental structural scaffold essential for forming a dry "steric zipper" structure in tau amyloid fibrils
20805522 A magnetic resonance spectroscopy case-control study shows metabolite abnormalities characterized by elevated myoinositol (mI)/creatine and decreased N-acetylaspartate/mI present several years before the onset of symptoms in MAPT mutation carriers.
20805224 Seeded aggregation and toxicity of {alpha}-synuclein and tau: cellular models of neurodegenerative diseases
20800603 Observational study of gene-disease association. (HuGE Navigator)
20720012 p5 is a 24-residue peptide, derived from p35, the Cdk5 neuronal activator, specifically inhibits Cdk5-p25 hyperactivity and tau hyperphosphorylation
20711177 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20711061 Observational study of gene-disease association. (HuGE Navigator)
20708332 the early age at onset a frontotemporal dementia reflects a marked pathogenic effect of the mutation involving a disturbance of microtubule binding, tau phosphorylation or a major acceleration of tau aggregation.
20683187 Subsequent testing revealed the R406W tau mutation in both individuals leading to a diagnosis of frontotemporal dementia [F]FDDNP retention broadly correlated with CSF levels of t-tau and p-tau.
20679343 Spectroscopic studies of GSK3{beta} phosphorylation of the neuronal tau protein and its interaction with the N-terminal domain of apolipoprotein E.
20678074 [review] The abnormally hyperphosphorylated tau of Alzheimer's disease (AD) is distinguishable from both normal and transiently hyperphosphorylated taus and is inhibitory when in the cytosolic/oligomeric state of AD and related tauopathies.
20678073 The fact that tau has unknown cellular functions is further evidenced by its involvement in cell cycle activated neurodegeneration.
20678071 Review summarizes evidence showing that tau truncation alone is sufficient to induce the complete cascade of neurofibrillary pathology, including hyperphosphorylation and accumulation of misfolded insoluble forms of tau.
20665688 Data provide information for the mechanism of tau aggregation, and the possible role of mercury(II) in the pathogenesis of AD.
20663882 Phosphorylation of tau at Thr212, Thr231, and Ser262 combined causes neurodegeneration.
20660113 results support the hypothesis that changes in the miRNA network may contribute to a neurodegenerative phenotype by affecting tau phosphorylation
20658996 Evidence for the involvement of proteases in the generation of tau pathology in neurodegenerative disease.
20658995 Functional implications of the association of tau with the plasma membrane.
20658994 NMR spectroscopy as a proteomics tool to characterize the phosphorylation patterns of tau, after in vitro phosphorylation by recombinant kinases.
20658988 Toxicity of extracellular phosphorylated tau for surrounding neurons.
20658986 From tau phosphorylation to tau aggregation.
20658984 Tau cleavage in a cell model of taupathy.
20650958 Retroposition of Rps23 mRNA occurred multiple times in different species but only generated another functionally expressed Rps23rg1-homologous gene, Rps23rg2, in mice.
20620663 Ventricular enlargement as a biomarker of Alzheimer's disease highly correlates with cerebrospinal fluid (CSF) measures of amyloid beta(1-42) peptide, but not with CSF Tau protein.
20615469 Amyloid-beta peptide alteration of tau exon-10 splicing is related to its activation of GSK-3beta which in turn phosphorylates SC35.
20606400 Inversion heterozygosity was also observed in a mother homozygous for the MAPT H2 haplotype, who transmitted the chromosome with the deletion to a proband with 17q21.31 microdeletion syndrome.
20599975 Unlike Alzheimer's disease where tauopathy is more globally observed in diverse brain regions, expression of tauopathy in brains of Parkinson disease (PD) with and without dementia is probably limited to nigrostriatal dopaminergic neurons.
20599474 In Alzheimer's disease patients from North India, levels of cerebrospinal fluid tau and ubiquitin are increased compared to those of controls.
20579400 Expression of MAPT protein isoforms of less than 70 kDa is correlated with a low sensitivity to taxanes in breast cancer.
20574532 Observational study of gene-disease association. (HuGE Navigator)
20571215 mitochondrial NH2-derived tau peptide distribution may exacerbate the synapse degeneration occurring in tauopathies, including Alzheimer's disease
20561037 We present the first Central-Eastern European family (Gdansk Family) with FTDP-17 because of a P301L mutation in microtubule-associated protein tau.
20553310 This review highlights a large body of evidence suggesting that tau hyperphosphorylation results from perturbation of cellular signaling, mainly through imbalance in the activities of different protein kinases and phosphatases.
20549384 Data suggest that detection of Tau protein in the serum of patients with ischemic stroke, but not its concentration, may be a bad prognostic factor for clinical outcome in early and late phase of IS.
20544828 Overexpression of tau in the subcortical region of 7-8-month-old transgenic mice results in a region-specific relative decrease in tau hyperphosphorylation (compared with total tau) in the subcortical area of the brain.
20538373 Cerebrospinal fluid tau and hippocampal volume changes later than that of Abeta, showing similar monotonous trends, reflecting disease progression from mild cognitive impairment to Alzheimer's.
20538372 The significance of the time course of MAPT biomarker abnormalities in Alzheimer disease correlates with hippocampal volume and radial distance compared with apolipoprotein E4 carriers and noncarriers.
20520830 These findings indicate that disruption of the normal equimolar 3R to 4R ratio may be sufficient to drive tau aggregation and that restoration of the tau isoform balance may have important therapeutic implications in tauopathies.
20513372 The cholinergic neurons of these nuclei, despite widespread expression of the P301L tau transgenic pR5 model of tauopathy, neither expressed human tau nor displayed immunoreactivity with antibodies AT8 and AT180 which recognize hyperphosphorylated tau.
20498436 The findings ofthis study suggested that the H1/H2 polymorphism in MAPT is not associated with human amyotrophic lateral sclerosis, and that lowering tau levels in the mutant SOD1 mouse does not affect the motor neuron degeneration in these animals.
20478262 By means of ATP-depletion, ubiquitinylation-deficient E36ts20 cells, a 19S proteasomal regulator subunit MSS1-siRNA approach, and in vitro ubiquitinylation studies, we demonstrated that ubiquitinylation is not required for normal tau degradation.
20473510 This review highlights the features that connect prion diseases with other cerebral amyloidoses and how these relate to neurodegeneration, with focus on tau phosphorylation.
20473135 Independently of age, disease duration, education level, and clinical severity indices, AD patients with an atypical onset have significantly higher levels of total tau in the CSF (P=0.023).
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20466736 Tau phosphorylation at Ser262 is crucial for Abeta42-induced tau toxicity in vivo.
20460118 Filamin-A and Myosin VI colocalize with fibrillary Tau protein in Alzheimer's disease and fronto-temporal dementia with parkinsonism linked to chromosome 17 and in Thy-Tau22 transgenic mice
20437541 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20415586 In this review, the intraneuronal accumulation of filamentous, hyperphosphorylated microtubule associated protein tau is the most thoroughly investigated molecular signature of frontotemporal lobar degeneration.
20379729 results show the presence of abnormally phosphorylated tau in CSF of a model tauopathy, the correlation of CSF p-tau181 levels with sarkosyl-insoluble p-tau181 in the brain and the correlation of CSF p-tau181 level with neurobehavioural impairment
20377816 Phosphorylation levels of tau at Thr(231), Ser(396), and Ser(409) were increased in cells transfected with V337M, R406W, and R406W mutant tau genes, respectively.
20375017 Tau potentiates nerve growth factor-induced mitogen-activated protein kinase signaling and neurite initiation without a requirement for microtubule binding
20359515 The effects of transgenic Tau on triose phosphate isomerase are investigated based on the hypothesis that its deficiency is related to neurodegeneration.
20357768 proposition of a new model in which caspase activation cleaves tau to initiate tangle formation, then truncated tau recruits normal tau to misfold and form tangles
20236174 Caudate atrophy seen in magnetic resonance imaging is a feature that can distinguish frontotemporal lobar degeneration-fused in sarcoma protein (FTLD-FUS) from FTLD-TAR DNA-binding protein-43 (TDP) protein, and FTLD-TAU protein.
20219685 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20193038 Accumulation of cytosolic hyperphosphorylated forms of human Tau proteins correlates with human Tau-mediated neurodegeneration in flies, supporting the key role of soluble cytosolic hyperphosphorylated Tau proteins as toxic species in vivo.
20171924 No known pathogenic mutation of either MAPT or PGRN was identified in Korean patients with progressive supranuclear palsy, frontotemporal dementia and corticobasal syndrome
20171924 Observational study of gene-disease association. (HuGE Navigator)
20159774 The DNA damage-activated kinases Chk1 and Chk2 may be involved in tau phosphorylation and toxicity in the pathogenesis of Alzheimer's disease.
20157246 MAPT gene is associated with mild congnitive impairement.
20157246 Observational study of gene-disease association. (HuGE Navigator)
20143409 the results from these three model systems suggest that a direct mechanistic link does not exist between tau aggregation and the unfolded protein response
20133804 Data show that FKBP52, which is abundant in brain, binds directly and specifically to Tau, especially in its hyperphosphorylated form.vv
20133017 In normal individuals, elevated p-tau(231), a marker of neurofibrillatory pathology, is related to both a decrease in declarative memory and progressive atrophy of the medial temporal lobe, suggesting its diagnostic potential in preclinical stage.
20097445 Tau-40/P301L transgenic rats express human tau mRNA and protein in the limbic cortex and associated white matter, hippocampus and spinal cord.
20085902 Tau expression but not excision repair cross-complementing 1 in advanced breast cancer predicts poor response to combination chemotherapy of paclitaxel and cisplatin
20070850 This study confirms that SNCA and the MAPT region are major genes whose common variants are influencing risk of Parkinson disease.
20070850 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20061629 Neither intraneuronal phospho-tau nor amyloid beta protein has obligatory effects on reducing the expression of genes important for memory and cognition in hippocampus of Alzheimer brains.
20045477 the effects of GRN and MAPT mutations are expressed in partly overlapping but distinct anatomical networks that link specific molecular dysfunction with clinical phenotype.
20020531 Sixteen different non-synonymous changes, eleven of which are novel variants, were identified in GRN AND MAPT.
20005921 we found no evidence that CALHM1 P86L is associated with altered CSF levels of the investigated Alzheimer's disease biomarkers A beta 42, tau and phospho-tau
20004218 The present results support the validity of the P301S tau mice as a model of human tauopathy.
19961883 Newborns have extremely high levels of phosphorylated tau in their CSF, and that these levels decrease during the first years of life. Tau phosphorylation in Alzheimer's disease may be a physiological response to Alzheimer-associated synaptotoxicity.
19959468 Results suggest that the formation of the 1:1 complex of Tau monomer and heparin plays an important role in the inducer-mediated Tau filament formation, providing clues to understanding the pathogenesis of neurodegenerative diseases.
19943189 Results describe the temporal profile for amyloid precursor protein, amyloid-beta and tau expression in primary cortical cultures from 3x transgenic-Alzheimer disease mice.
19940479 alterations in gene copy number of PGRN and MAPT are not a cause of disease in a collection of frontotemporal lobar degeneration patients
19940479 Observational study of gene-disease association. (HuGE Navigator)
19938685 Recent studies have identified 44 different mutations in more than 100 families with FTDP-17 (MAPT), and 66 different mutations in more than 100 families with FTDP-17 (PGRN).
19936237 Diabetes mellitus can accelerate onset and increase severity of disease and exacerbate tau deposition
19926863 These data provide mechanistic insight into how disruptions in lipid metabolism can determine neuronal response to accumulating oligomeric amyloid-beta(42).
19923278 Amyloid-beta alone does not cause neurodegeneration but induces toxicity through phosphorylation of wild-type tau in an NMDA receptor-dependent pathway.
19919107 Tau 6P and 6D isoforms are endogenous inhibitors of tau filament formation.
19915575 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19914360 Study examined splicing factors located on chromosome 21 for their effect on tau exon 10 and discovered that one of them, hnRNPE3 (PCBP3), modestly activates splicing of exon 10 by interacting with its proximal downstream intron around position +19.
19912324 Our findings show that the H1 haplotype is a significant risk factor for Parkinson Disease
19912324 Observational study of gene-disease association. (HuGE Navigator)
19897570 the importance of the Tyr residue located at position 310, not at other positions, was clearly shown
19895707 suggests that the proline-rich domain and the microtubule-binding domain of tau are both involved in binding to and bundling F-actin.
19889475 Observational study of gene-disease association. (HuGE Navigator)
19879020 This study supported that genetic variability within H1 MAPT haplotype confers susceptibility to parkinson disease. H1 risk sub-haplotypes associated with parkinson disease and progressive supranuclear palsy are different.
19879020 Observational study of gene-disease association. (HuGE Navigator)
19858456 At the time of Alzheimer disease diagnosis, a combination of high CSF tau without proportionally elevated p-tau-181 is associated with a faster rate of cognitive decline.
19826005 Data demonstrate that low micromolar zinc accelerates the fibrillization of human Tau protein via bridging Cys-291 and Cys-322 in physiological reducing conditions.
19812213 Observational study of gene-disease association. (HuGE Navigator)
19794916 amyloid precursor protein, but not tau, has a role in neuronal accumulation of amyloid peptides
19786698 There seem to be differences in patterns of temporal lobe atrophy across the MAPT mutations; there seems to be a possible association between mutation function and pattern of temporal lobe atrophy
19782075 It is therefore possible to speculate that the mechanism by which Abeta(42) interacts with tau in the pathogenesis of Alzheimer's disease is by down-regulating endogenous wnt signalling
19775775 These results suggest H63D HFE increases tau phosphorylation via GSK-3beta activity and iron-mediated oxidative stress.
19770469 Baseline CSF levels of tau phosphorylated at threonine 181 are independently associated with subsequent disease progression, as reflected by hippocampal atrophy rate.
19768372 a novel Val75Ala MAPT mutation in patient with frontotemporal dementia
19766248 frontotemporal dementia with parkinsonism linked to chromosome 17 (FTDP-17) resulting from the microtubule associated protein tau (MAPT) gene IVS10+16C>T splice site mutation
19749420 data might indicate that the higher CSF t-tau level is associated with more neurofibrillary tangles pathology and more severe impairment of short-term memory in Alzheimer's disease patients
19736351 Observational study of gene-disease association. (HuGE Navigator)
19730171 All of our Frontotemporal Lobar Degeneration patients were found to be negative for MAPT mutations
19730170 both PGRN and MAPT genes seem not to be the major genetic cause of frontotemporal lobar degeneration in Northern Italy
19700222 Activation of transgenic c-Abl by amyloid beta precursor proteinbeta promotes tau phosphorylation through Tyr15 phosphorylation-mediated Cdk5 activation.
19695742 The prevalence of tau-positive grains has been underestimated in the very old population; as neurofibrillary tangles, they appear to be a constant accompaniment of age not associated with dementia.
19693433 differences in solubility and phosphorylation may contribute, at least in part, to the formation of distinct tau deposits, but may also have implications for the clinical differences between Alzheimer's disease and Pick's disease
19691919 Both total-tau and phospho-tau levels showed significant correlation with age, which was more pronounced in older population.
19686388 tau-induced changes in axonal transport may be an underlying theme in neurodegenerative diseases associated with isoform specific changes in tau's interaction with microtubules
19684401 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19681044 Tau in prostate cancer cells does not resemble that from normal adult brain and support the hypothesis that tau is a multifunctional protein.
19667268 In univariate analyses, Tau- and ER-positive status were both associated with better DFS and OS whereas greater tumor size, high grade, lymph node- and HER2-positive status were each associated with worse DFS and OS.
19665462 expression of mutated tau results in significant structural and functional changes in neurons, but that these changes occur independent of mature neurofibrillary tangle formation
19654187 Studies show that components of a selective form of autophagy, chaperone-mediated autophagy, are involved in the delivery of cytosolic Tau to lysosomes for this limited cleavage.
19647741 Data suggest that the state of tau3 phosphorylation by protein kinase A affects the mode of 14-3-3zeta binding and by this means might modify tau filament formation.
19625749 The mechanism by which the tau unfolded molecule evolves to the well ordered helical tau filaments is a very slow process, when followed in the absence of aggregation inducers.
19591849 These data unravel novel mechanisms of tau hyperphosphorylation during G-protein-coupled receptor activation and are the first to show that stimulation of D1 receptors could have a profound influence on the neuronal cytoskeletal constituent tau.
19573950 This case-control association study in a Greek cohort of 196 parkinson disease cases and 163 healthy controls. In our study, the MAPT H1 haplotype was found to be significantly associated with Parkinson disease.
19560101 Positivity for at least one marker increased the probability 38 times of belonging to the AD group (P < 0.0001)
19559700 co-localization of somatostatin expression with Abeta (65.43%) with Abeta and tau (19.75%) and with tau (2.47%) in Alzheimer's disease
19558713 The data of this study supported the overall genetic role of MAPT and the H1 haplotype for PD susceptibility in Greek patients.
19558713 Observational study of gene-disease association. (HuGE Navigator)
19549281 Herein, we demonstrate that oleocanthal abrogates fibrillization of tau by locking tau into the naturally unfolded state.
19542619 Expression of a truncated human tau protein induces aqueous-phase free radicals in a rat model of tauopathy.
19542604 Mounting evidence summarized in this review suggests that tau tyrosine phosphorylation is an early event in the pathophysiology of Alzheimer's disease.
19540327 The tau isoform shift shows an apparent disconnect to neurogenesis, migration and volume growth, but coincides with the formation of synapses and the appearance of stable microtubules.
19527721 Excitatory amino acid transporter 2 associates with phosphorylated tau and is localized in neurofibrillary tangles of tauopathic brains
19525898 results suggest that more contacts between rough endoplasmic reticulum (RER) membranes and mitochondria resulting from the accumulation of tau at the surface of RER membranes might contribute to tau-induced neurodegeneration
19524111 The optimal CSF P-tau(181P) cut-off level for discriminating AD from non-AD dementias was 50.4pg/mL. Optimal CSF P-tau(181P) cut-off levels differed between non-AD diagnostic dementia categories.
19523877 The CSF Tau AD profile was more common in patients with SCI (31 of 60 [52%]), naMCI (25 of 37 [68%]), and aMCI (56 of 71 [79%]) than in healthy controls (28 of 89 [31%]).
19517062 Data show that D-ribose reacts with Tau protein rapidly, producing ThT-positive aggregations which had high cytotoxicity.
19498037 Elevated or reduced exon 10 inclusion caused by FTDP-17 mutations can be reversed by trans-splicing.
19491104 The pathological Tau/JIP1 interaction requires phosphorylation of Tau, and Tau competes with the physiological binding of JIP1 to kinesin light chain.
19478088 Cyanine dye 3,3'-diethyl-9-methyl-thiacarbocyanine iodide (C11) was utilized to modulate Tau polymerization in two model systems, an organotypic slice culture model and a split green fluorescent protein complementation assay in Tau-expressing cells.
19450659 This study identified risk haplotype [GAC+G] for parkinson disease(PD). In addition, haplotype AAC+A was strongly associated with early onset PD (age at onset < or =40 years) and AAC+G haplotype showed a weak association with late onset PD.
19450558 The repeat-number-dependent aggregation model of tau microtubule-binding domain, together with the function of each repeat, reported in this paper should help to devise a method of preventing tau paired helical filaments formation.
19433664 In individuals with very mild Alzheimer dementia, lower CSF Abeta 42 levels, high tau or ptau181 levels, or high tau:Abeta 42 ratios quantitatively predict more rapid progression of cognitive deficits and dementia.
19429119 Our data suggest that Leptin regulates tau phosphorylation through a pathway involving both AMPK and GSK-3beta.
19401603 Dephosphorylation of wild-type Tau was reduced in brain extracts of Pin1-knockout mice, and this reduction was not observed with P301L and R406W.
19371722 These results implicate 14-3-3zeta/tau heterodimers as key regulators of SSH1 activity in keratinocytes and suggest they play a role in cytoskeleton remodeling during cell migration.
19365643 Results describe a cohort of frontotemporal lobar degeneration families with a homogeneous genetic background within and around the MAPT locus.
19356824 The hyperphosphorylated transgenic tau accumulates in the nerve fibre layer and, from 2 months of age, aggregates into filamentous inclusions in retinal ganglion cells of human P301S tau transgenic mice.
19324008 The significant aggregation of 4R-tau by 14-3-3zeta suggests that 14-3-3 may act as an inducer in the generation of 4R-tau-predominant neurofibrillary tangles in tauopathies.
19308965 found no evidence for allelic or haplotypic association, with SNPs in the MAPT gene and late-onset Alzheimer's disease. SNP rs242557 is nominally significant in the APOE4 positive individuals.
19308965 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19307538 subgroup of patients with extremely high CSF levels of tau and tau phosphorylated at threonine 181 shows a distinct cognitive profile with severe impairment of memory, mental speed, and executive functions, which cannot be explained by disease severity.
19304664 FTDP-17 missense mutations, by promoting phosphorylation at Ser(202), inhibit the microtubule assembly-promoting activity of tau in vitro.
19273536 Sut-2 as a gene required for human tau neurotoxicity in C. elegans.
19264130 The current studies show for the first time activity for NAP in a "pure" tauopathy model, positioning it as a promising drug candidate in multiple neurodegenerative tauopathies.
19255408 In subjects who have mutations of MAPT, patterns of atrophy seen on head magnetic resonance imaging (MRI) show greater gray matter loss, compared to head MRI of subjects with mutations in progranulin (PGRN).
19240967 These data raise the possibility that increased tau phosphorylation may influence long-term clinical responsiveness to cholinesterase inhibitors.
19236926 Ventricular expansion maps correlate with pathological and cognitive measures in AD, and may be useful in future imaging-based clinical trials.
19232747 Neurodegenerative lesions caused by human truncated tau promote inflammatory response manifested by upregulation of immune-molecules (CD11a,b, CD18, CD4, CD45 and CD68) and morphological activation of microglial cells in a rat model of tauopathy.
19226187 study shows 441-residue tau is dynamic in solution with distinct domain character & network of transient long-range contacts important for pathogenic aggregation;single-residue view by NMR analysis reveals insights of interaction of tau with microtubules
19224617 This study found that modest Modest associations (uncorrected P < 0.05) were observed for common variants around MAPT in Australia patient with Parkinson's disease.
19224617 Observational study of gene-disease association. (HuGE Navigator)
19221889 Amyloid-beta and Tau affected aging-prone astrocyte cell death, metabolism and cytoskeleton.
19190923 our study shows that tau truncation appears after tau hyperphosphorylation in the brain of two transgenic mouse models, and that accumulation of truncated tau is closely associated with neurons undergoing degeneration or containing neurofibrillary tangles
19165922 We found that inversion of the MAPT region is similarly polymorphic in other great ape species, and we present evidence that the inversions occurred independently in chimpanzees and humans
19158426 results show each of the 4 exonic tau mutations tested accelerate degeneration in giant neurons of the lamprey compared to WT isoforms; patterns of tau distribution, phosphorylation & cytopathology vary among WT & mutant isoforms in a single neuron
19155101 This study compares equal tau gene transfer in 3- and 20-month-old rats, in order to test the hypothesis that late middle-aged rats are more susceptible to neurodegeneration.
19153649 While tau protein seems to be quite a reliable marker of AD, the role of beta-amyloid(1-42) and cystatin C in AD diagnosis remains at least questionable.
19126401 The role of PP2A in the phosphorylation of P301L mutant human tau and in neurofibrillary tangle pathology in vivo was determined.
19112391 Measurement of tau protein or phosphorylated-tau protein in cerebrospinal fluid seems to be of no importance in the differential diagnosis of early stage multiple sclerosis.
19091059 We conclude that although pathogenic MAPT mutations are rare in Northern Finland, the MAPT H2 allele may be associated with increased risks of FTLD and eoAD in the Finnish population.
19091059 Observational study of gene-disease association. (HuGE Navigator)
19090983 Data show that abnormal splicing with inclusion of exon 10 into tau mRNA has been observed in progressive supranuclear palsy and Alzheimer's disease patients.
19074461 MAPT deletion exacerbates the Niemann-Pick type C phenotype.
19070646 Our data suggest that the 347C polymorphism in the promoter of MAPT gene, which is associated with an up-regulation of the gene expression, is a susceptibility factor in sporadic AD.
19070646 Observational study of gene-disease association. (HuGE Navigator)
19057915 the combination of PARK2 gene deletion with hTauVLW over-expression in mice produces abnormal hyperphosphorylated tau aggregates, similar to those observed in the brain of patients diagnosed with certain tauopathies
19039589 Patients with tau-positive expression may derive less benefit than tau-negative from paclitaxel therapy in metastatic breast cancer.
19022385 rs1880753 marker located 160 kb and 50 kb upstream of MAPT and CRHR1 genes respectively showed consistent association with disease risk and an earlier age at onset, suggesting that it could act as cis modifying factor of MAPT gene expression
19022385 Observational study of gene-disease association. (HuGE Navigator)
19011737 P-tau discriminated between vascular dementia patients and controls, but not between Alzheimer disease patients and the other groups. Higher P-tau values did predict a more rapid evolution of cognitive decline.
19010781 Conformational diversity of wild-type Tau fibrils specified by templated conformation change.
19001166 Considering pathologic abnormalities of these tauopathies and involvement of tau mutations seen in familial forms, MAPT gene represents most likely cause driving association.
19001166 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18992725 H/I resulted in a significant increase in tau fragments generated by caspase activation and a marked decrease in tau phosphorylation at residue T231 in cortex of wild-type but not transgenic mice.
18992292 Each FTDP-17 tau mutation not only site-specifically inhibits tau dephosphorylation on some sites but also promotes dephosphorylation by phosphatases on other sites.
18991351 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18985386 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18971445 Truncated tau production, which selectively affects brainstem neuron susceptibility, can be considered a specific marker for PSP. Tau form ratio was the lowest in progressive supranuclear palsy with no overlap with any other neurodegenerative illness.
18948254 Tau mutations likely play a role in neurodegenerative diseases (Review)
18946722 Report co-localization of hyperphosphorylated tau and caspases 3/6 in the brainstem of Alzheimer's disease patients.
18940799 FTDP-17 mutations in Tau alter the regulation of microtubule dynamics and demonstrate an "alternative core" model for normal and pathological Tau action
18930955 Phosphorylation and microtubule binding plays a crucial role in the regulation of tau toxicity when misexpressed.
18930114 No differences in genotypic distributions between the dementia in Parkinson's disease,Parkinson's disease and control.
18930114 Observational study of gene-disease association. (HuGE Navigator)
18925637 We found differences between mouse and human tau in the regulation of exon 10 inclusion. Despite these differences, the isoform splicing pattern seen in normal human brain is replicated in our mouse models.
18854867 The data suggest that H1 haplotype is associated with a particular cerebral morphology that may increase the susceptibility of the healthy carriers to develop neurodegenerative diseases such as sporadic tauopathies.
18854867 Observational study of gene-disease association. (HuGE Navigator)
18848323 Observational study of gene-disease association. (HuGE Navigator)
18843496 Data show that the pathological deposits with antibodies against tau has involved in the neuropathogenesis of the amyotrophic lateral sclerosis/parkinsonism-dementia complex of Guam.
18841019 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18830724 Meta-analysis of gene-disease association. (HuGE Navigator)
18806919 Data show that in AD patients, cortisol serum levels are significantly inversely correlated with T-tau, P-tau 181 and P-tau 231 protein levels and T-tau/Abeta 1-42 ratios in CSF.
18805362 Data show that total serum bilirubin and mean serum Tau levels of infants who manifest auditory neuropathy, neurologic abnormalities, or EEG abnormalities are significantly higher than in infants without these abnormalities.
18803694 MAPT missense mutations can directly promote tau filament formation at different stages of the aggregation pathway.
18803648 Whilst dementia severity is closely related to impaired cerebral glucose metabolism, CSF t-tau is less closely related and appears to be less well suited for assessment of disease progression.
18803399 According to circular dichroism and NMR spectroscopy, Tau remains largely disordered upon binding to Cu(II), although a limited amount of aggregation is induced
18785640 The major H1 subhaplotype in Guadeloupe, determined by analysis of linkage desequibrium, differed from the major Caucasian subhaplotype, but corresponded to minor alleles previously described.
18785640 Observational study of gene-disease association. (HuGE Navigator)
18771816 Pathological accumulation of amyloid-beta protein and hyperphosphorylation of tau develop concomitantly within synaptic terminals of Swedish mutant transgenic mice.
18768919 Observational study of genetic testing. (HuGE Navigator)
18765933 Haplotype frequencies vary between those developing Alzheimer's disease in Down syndrome before 45 and those developing dementia after this age
18725924 Residue K280 can adopt a loop/turn conformation in WT MTBR2 and that deletion of this residue, which can adopt nonextended states, leads to an increase in locally extended conformations near the C-terminus of PHF6*, aggregation-initiating sequence.
18702695 Expression levels of misfolded truncated tau determine life span in transgenic rat model of tauopathy without causing neuronal loss or correlating with terminal neurofibrillary tangle load.
18679696 simultaneous presence of human mutated Tau(VLW) and plaque-amyloid (and/or APP(SW)) potentiates and anticipates tau phosphorylation at the 12E8 epitope, intensifying pyramidal neuron immunostaining and tau filament formation in this alzheimer's model
18671940 This work is focused on the fourth microtubule-binding repeat (R4) of tau, which has an O-GlcNAcylation site-Ser356.
18668363 ER gene transcription carries weak predictive significance for benefit from endocrine therapy or for outcome in early breast cancer. The predictive significance is possibly exerted via MAP-Tau gene expression.
18662339 Results suggest that differential regulation of phosphorylation is important for neurofibrillary tangle formation in neurodegenerative diseases with tau pathology.
18661559 These results suggest for the first time that variation of alpha-synuclein modulates neurofibrillary tau pathology and support the recent observations of an interaction of alpha-synuclein and tau in neurodegeneration.
18658135 Imbalance of 3R- and 4R-tau in DS brain by Dyrk1A-induced dysregulation of alternative splicing factor-mediated alternative splicing of tau exon 10 represents a novel mechanism of neurofibrillary degeneration
18641620 review of modifications, phosphorylation and a specific form of glycosylation, O-linked -N-acetylglucosaminylation by O-GlcNAc, relevant to pathological tau phosphorylation
18640988 mature, parkin null, over-expressing human mutated tau (PK(-/-)/Tau(VLW)) mice have altered behaviour and dopamine neurotransmission, tau pathology in brain and amyloid deposition in brain and peripheral organs
18636984 These findings establish HDAC6 as a tau-interacting protein and as a potential modulator of tau phosphorylation and accumulation.
18631770 MAPT is a susceptibility gene for progressive supranuclear palsy.
18596978 using electrophoretic mobility shifting assay (EMSA) in the presence of DNA with different chain-lengths, we observed that tau protein favored binding to a 13 bp or a longer polynucleotide.
18588978 We conclude that the phosphorylation of tau by GSK-3beta either prior to or following polymerization promotes polymer/polymer interactions that result in stable clusters of tau filaments.
18587238 although PSEN1 mutations are the most frequent cause, the MAPT R406W mutation is an important cause of early-onset familial dementia clinically diagnosed as Alzheimer's disease in Japanese
18586097 Increased demethylation of PP2A mediated by Abeta overproduction or estrogen deficiency may contribute to the reduced PP2A activity observed in the AD brain, resulting in the compromised dephosphorylation of abnormally hyperphosphorylated tau.
18583940 Findings argue for a role of tau in chromosome stability by means of its interaction with both microtubules and chromatin.
18562203 Collectively, these findings suggest that Tau nitration at Tyr 18 may be linked to astrocyte activation, an early event associated with amyloid plaque formation.
18561034 parkin may counteract the alteration of tau metabolism in certain neurodegenerative diseases with tau cytopathy and parkinsonism
18558718 VQIINK (280) and VQIVYK (311) are the major, if not sole, critical regions that directly mediate intermolecular contact between tau molecules during the early phases of Tau aggregation.
18541914 This endophenotype-based approach provides evidence for a gene (MAPT SNPs)-physiological environment (Abeta deposition) interaction that places changes in cerebrospinal fluid tau after Abeta deposition.
18541914 Observational study of gene-disease association. (HuGE Navigator)
18511295 A caspase-cleaved NH2-terminal tau fragment of 20-22 kDa, consistent with the size of the N-terminal 26-230 amino-acid neurotoxic fragment of tau, is generated in vitro in differentiated human SH-SY5Y cells.
18509094 This study supports a role for MAPT in the pathogenesis of familial and idiopathic Parkinson disease (PD).
18509094 Observational study of gene-disease association. (HuGE Navigator)
18500754 Two hsc70 binding sites on tau are identified, as well as hydrophobic amino acids crucial for hsc70 binding.
18495933 The data are incompatible with tau acting as a monomer; rather, they indicate that two tau molecules associate in an antiparallel configuration held together by an electrostatic "zipper" of complementary salt bridges.
18495299 Observational study of gene-disease association. (HuGE Navigator)
18490011 Both animal and cell models, which were regulated under the natural tau promoter (of rat origin), provide authentic and reliable models for tauopathy, and offer valuable tools for understanding the molecular events underlying tauopathies including AD.
18467692 Abeta and tau pathology are consistent with a model in which both synaptic loss and dysfunction are linked to a synaptic amyloid cascade within the synaptic compartment.
18462837 results suggest that in cognitively healthy elderly subjects, biochemical changes in CSF tau and Abeta42 have an effect on cerebral function; CSF biomarkers and EEG theta activity might indicate early abnormal degenerative changes in the brain
18460467 relative resistance to phosphatases might be a common feature of Cdk5 substrates and could contribute to the hyperphosphorylation of CRMP2 and Tau observed in Alzheimer disease
18458217 The ratio of CSF tau/A beta(42) is a sensitive and specific biomarker at discriminating frontotemporal lobar degeneration from Alzheimer disease in patients with known pathology.
18445112 study describes the transient elevation of total tau levels in CSF of patients with Wernicke's encephalopathy, as well as the absence of elevated total tau in alcohol withdrawal delirium
18431254 Taken together, the in vitro models and findings in AD suggest that in the presence of ubiquinone, Hirano bodies may result from the interaction of actin and other proteins, including tau.
18431250 These results indicate that tau is not randomly proteolyzed at different domains, and that proteolysis occurs sequentially from the C-terminus to inner regions of tau in AD progression.
18430997 study found that the level of the catalytic subunit of PP2A(PP2Ac) was dramatically decreased in adult Down syndrome brain, and this decrease correlated negatively with tau leveland phosphorylation at several abnormal hyperphosphorylation sites
18413467 Mutations in the gene encoding the microtubule-associated protein tau (MAPT; OMIM +157140) on chromosome 17 have been found in many kindreds with familial FTDP.
18403055 We found that the older control group had lower Abeta1-42 and higher (p)tau compared to the younger control group. This suggests that older individuals may have Alzheimer's disease pathology, even in the absence of objective cognitive impairment.
18395614 These results indicate the existence of a correlation between impairment of cerebral metabolism, estimated through FDG-PET, and CSF Tau protein levels.
18382889 Senile systemic amyloidosis was associated with age, myocardial infarctions, the G/G (Val/Val) genotype of the exon 24 polymorphism in the alpha2-macroglobulin (alpha2M), and the H2 haplotype of the tau gene
18382889 Observational study of gene-disease association. (HuGE Navigator)
18380664 Expression of microtubule-associated protein tau, a major component of tangles, with an adeno-associated virus vector induces neuropathological sequelae in rats that are similar to those seen in human tauopathies.
18359772 analysis of tau filament formation and the role of dimerization
18351740 Results describe the detailed characterization of tau in human cerebrospinal fluid.
18338250 Data provide the first evidence that 17beta-estradiol can inhibit PKA overactivation and PKA-induced tau hyperphosphorylation, implying a preventive role of 17beta-estradiol in AD-like tau pathology.
18322394 FTDP-17T is associated with symmetric frontotemporal atrophy and FTDP-17U with an asymmetric degenerative process in parkinsonism and frontotemporal dementia.
18319590 combined gene effects between 14-3-3 zeta (intron 4, rs 983583) polymorphism and tau (intron 9, rs 2471738) polymorphism might be responsible for susceptibility to Alzheimer disease
18319590 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18318434 Our results identify a molecular mechanism by which proinflammatory stimuli affect tau pathology via the GSK-3beta signaling pathway in skeletal muscle.
18315566 First direct protein sequence analysis of tau post-translational modification shows how aggregatory characteristics of progressive supranuclear palsy-tau differ from Alzheimer brain.
18312411 This systematic study of the linkage-dependent contribution of each repeat peptide to the paired helical filament formation of tau microtubule-binding domain (MBD) is useful for understanding the essence of short and long filament formation of tau MBD.
18307268 Patients with mutations may be affected by frontotemporal dmentia and parkinsonism linked to chromosome 17.
18307033 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18284428 Alzheimer disease-like clinical phenotype in a family with FTDP-17 caused by a MAPT R406W mutation.
18276036 Our data suggest that there is an interaction between age and the expression of MAPT in the brain.
18272392 The observed effect of tau protein on neurons (in neuroblastomas and primary cultures of hippocampal and cortical neurons) is through M1 and M3 muscarinic receptors.
18234697 Observational study of gene-disease association. (HuGE Navigator)
18216194 Aggregated tau in neurons can be associated with caspase activation, but caspase activation is not sufficient to cause acute neuronal death in this transgenic mouse model.
18210157 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18185033 Observational study of gene-disease association. (HuGE Navigator)
18185033 To investigate associations of APOE, APOE promoter (G-219T), and tau protein exon 6 polymorphisms (47 and 53) and a history of self-reported concussion in college athletes
18184373 There is an increased neurogenesis during tau hyperphosphorylation and cell cycle events during abnormal tau phosphorylation and tau aggregation preceding neuronal death and neurodegeneration.
18182010 Data show that tau overexpression leads to impaired retrograde and anterograde organelle transport, while the microtubule skeleton appears intact.
18177439 Observational study of gene-disease association. (HuGE Navigator)
18166610 MAPT and PGRN are responsible for the largest number of familial cases. Each of these genes differs by disease mechanism. Moreover mutations in both genes are associated with significant interfamilial and intrafamilial phenotypic variation.
18163405 Observational study of gene-disease association. (HuGE Navigator)
18162161 Our study supports the hypothesis that genetic variability in the MAPT gene confers susceptibility to PD.
18162161 Observational study of gene-disease association. (HuGE Navigator)
18093153 report describes a tau S305S family where mutation carriers have frontotemporal dementia and parkinsonism; findings support previous studies demonstrating that the S305S mutation influences splicing of tau exon 10 & results in an overproduction of 4R tau
18072964 Observational study of gene-disease association. (HuGE Navigator)
18072964 Our study shows no evidence for an association between MAPT gene variations and sCJD, and some weak evidence for an association to vCJD
18070606 Syk is also a tau kinase, phosphorylating tau in vitro and in CHO cells when both proteins are expressed exogenously.
18065436 multidisciplinary study of multiple system tauopathy with presenile dementia kindred; mutation +3 in intron 10 of Tau can give rise to a picture of FTD or atypical PSP; haplotype of wild-type allele may act as a modifier of disease presentation
18052981 Tau phosphorylation at proline-rich region by dual-specificity tyrosine-phosphorylated and -regulated kinase 1A and at C-terminal tail region by glycogen synthase kinase-3beta affected its microtubule assembly activity and self-aggregation differently.
18038270 The molecular interactions between PrP and tau protein highlight a potential role of tau in the biological function of PrP and the pathogenesis of transmissible spongiform encephalopathies.
18022644 No patients had mutations of MAPT sporadic and familial PSP.
18022644 Observational study of gene-disease association. (HuGE Navigator)
18007595 Data demonstrate that aged (>20 months old) mice expressing wild-type human tau display impaired place learning and memory, even though they do not form neurofibrillary tangles or display neuronal loss.
17986027 An impaired control of glycogen synthase kinase-3beta activity by insulin receptor-mediated signalling plays a role in the pathogenesis of AD, facilitating tau protein phosphorylation and neurofibrillary tangle formation.
17976912 Thus, it is proposed that the negative charge present in taurine may be involved in the binding to tau protein, facilitating its assembly.
17954934 BAG-1 associates with Tau protein in an Hsc70-dependent manner.
17951083 Data show that high t-Tau levels in CSF are found in pediatric patients with a brain tumor, patients with hydrocephalus and patients with a serious CNS infection.
17932487 the N-terminal projection domain of tau binds to the C-terminus of the p150 subunit of the dynactin complex
17925548 Observational study of gene-disease association. (HuGE Navigator)
17920160 The evidence that P-tau231 and IP are the earliest markers for the neuronal damage related to AD awaits longitudinal study.
17914261 Despite the increased CSF concentrations of amyloid-beta, there were no signs of an Alzheimer disease-indicating tau pattern in CSF of Down syndrome patients, strengthening the theory of Abeta pathology preceding tau pathology in Alzheimer's.
17908237 This indicates that if the majority of tau is phosphorylated at S396/S404, in combination with increased GSK3beta activity, tau aggregation is favored.
17898350 Observational study of gene-disease association. (HuGE Navigator)
17898350 while the extended MAPT H1 and H2 haplotypes do not appear to confer risk for frontotemporal dementia development, the H2 haplotype appears to modify age at onset and functionally shows a more severe decline of glucose utilization in frontal brain areas
17889968 P-tau(231) is the strongest predictor of the decline from MCI to AD. IP levels uniquely show longitudinal progression effects. These results suggest the use of CSF biomarkers in secondary prevention trials.
17826340 Observational study of genotype prevalence. (HuGE Navigator)
17822846 The levels of apoE in cerebrospinal fluid were also correlated to the levels of Tau and the possibility is discussed that the level of apoE in cerebrospinal fluid may be used as a marker of neurodegeneration.
17727636 Our results demonstrate that dysregulation of combinatorial splicing might serve as a signature for aging-related diseases, and the polony assay could be widely adapted for the study of other tauopathies
17723255 This study presents a case of Alzheimer's disease with a deletion of the lysine residue at codon 280 (DeltaK280) in exon 10-encoded microtubule-binding repeat domain of the tau gene (MAPT).
17721707 We demonstrated increased but largely variable 4R tau/3R tau mRNA ratios in FTLD and PSP cases, suggesting heterogeneous pathophysiological processes within these disorders.
17707586 Our study does not support the theory that chromosomal rearrangements in the Tau region of chromosome 17 are a cause of FTLD.
17685560 Synthesis of phenylthiazolyl-hydrazide derivative (PTH)showed that it was active in inhibiting tau aggregation and in disassembling preformed aggregates. Analysis of the binding epitope shows strong interactions between the tau and the ligand.
17683088 Tau and alpha-synuclein are involved in shared or converging pathways in pathogenesis of Parkinson's disease(PD). Tau inversion influences development of cognitive impairment and dementia in patients with idiopathic PD.
17662000 novel MAPT mutation (P301T) is associated with familial frontotemporal dementia.
17661153 The H1/H1 genotype carriers showed a significant increase in 4R/3R mRNA ratio, suggesting that this genotype could modulate the tau mRNA splicing.
17637803 Observational study of gene-disease association. (HuGE Navigator)
17637803 Role of MAPT H1 haplotypes in the etiology of Parkinson's disease may be ethnically dependent.
17608454 Our results are not consistent with a nucleation-elongation reaction but are consistent with an allosteric regulation model; the presence of small molecules induce a conformational change that decreases the thermodynamic barrier for polymerization.
17602795 In both cell culture and post-mortem brain tissue, we show that the protective MAPT H2 haplotype significantly expresses two-fold more 2N (exons 2+3+) MAPT transcripts than the disease-associated H1 haplotype.
17565981 GSK3beta facilitates the association of T4 and T4C3, and the presence of caspase-cleaved tau is necessary for the evolution of tau oligomers into Sarkosyl-insoluble inclusions even though it is not extensively phosphorylated
17562708 phosphorylation sites in tau from Alzheimer brain show that casein kinase 1delta may have a role, together with glycogen synthase kinase-3beta, in the pathogenesis of Alzheimer disea
17561815 Intermolecular disulfide crosslinking along with PHF6 hexapeptide facilitates tau oligomerization; this event is accompanied by cysteine-independent intermolecular bridging of microtubule-binding domain, leading to assembly of higher-order oligomers.
17555970 Fine mapping of the MAPT region has identified sub-clades of the MAPT H1 haplotype which are specifically associated with neurodegenerative disease
17517691 the FTDP-17 tauV337M mutation has a role in impairment in impulse control that is exacerbated by age
17514749 Observational study of gene-disease association. (HuGE Navigator)
17514749 Strong evidence that the H1 clade, which contains MAPT and several other genes, is a risk factor for Parkinson's disease.
17512092 Increasing P-tau levels during cognitive decline and conversion to dementia suggest that P-tau may be useful as a longitudinal marker of the neurodegenerative process.
17499212 The epitope of anti-tau mAb Tau5 was mapped to the human tau sequence 218-225, which is not phosphorylated in vivo.
17493040 Review focuses on tau dysfunction for neurodegeneration and discusses mutations in the Tau gene in cases with frontotemporal dementia and parkinsonism linked to chromosome 17 (FTDP-17).
17409229 Levels of early-stage aggregated tau species (140 and 170 kDa), before the formation of neurofibrillary tangles, is associated with the development of functional deficits during the pathogenic progression of tauopathy in a transgenic mouse model.
17389797 There were dramatic changes in t-tau protein levels throughout the clinical course of Creutzfeldt-Jakob disease patients
17386961 These findings do not support an association of MAPT with FTD but do not rule out its association with other tauopathies.
17386961 Observational study of gene-disease association. (HuGE Navigator)
17385861 Transition between vastly different healthy and pathological forms of tau was studied.
17376439 These results suggest that phosphorylation of tau plays a dual role in modulating the activity of proteasome.
17373874 REVIEW: Microtubule-associated protein tau as a therapeutic target in neurodegenerative disease and their molecular rationales
17362999 In this model we suggest a possible role for tau phosphorylation, but not for tau aggregation, in the cognitive impairment found in the transgenic mouse.
17357082 Genome-wide association study of gene-disease association. (HuGE Navigator)
17341679 The tau-4R isoform essentially contributes to hippocampal development by controlling proliferation and differentiation of neuronal precursors.
17318302 Comparison of the tau genotype/haplotype carrying the proline(301)serine mutation and the initial clinical sign shows association between H1/H1 allelic genotype and parkinsonism and between H1/H2 genotype and personality change.
17311412 The N-terminal region projects from the microtubule surface, and the lack of chemical shift variations when compared with free Tau proves that this region can regulate microtubular separation without adopting a stable conformation.
17309878 findings suggest that disruption of the microtubule network in presynaptic nerve terminals could constitute early events in the pathological process leading to synaptic dysfunction in tau V337M pathology
17307736 analysis of the tau-microtubule interaction
17304350 Inhibition of Hsp90 led to decreases in p-tau levels independent of heat shock factor 1 (HSF1) activation.
17274033 Observational study of gene-disease association. (HuGE Navigator)
17274033 Mutations in exons 1 and 10 of TAU were associated with progressive supranuclear palsy.(
17266761 Our data suggest that the tagged SNPs forming the H1c haplotype at the MAPT locus do not have a causal role in the pathogenesis of late onset Alzheimer's disease
17204369 Observational study of gene-disease association. (HuGE Navigator)
17192721 Observational study of gene-disease association. (HuGE Navigator)
17192721 The data presented here suggest that subhaplotypes of haplotype H1 may confer susceptibility to Parkinson's disease (PD), and that either allelic heterogeneity or different haplotype composition explain the divergent haplotype results.
17192672 Biochemical features of Alzheimer disease is modification by phosphorylation of the microtubule-associated protein TAU.
17186252 The novel Tau mutation G335S in patient with Frontotemporal Lobar Degeneration .
17185385 Observational study of gene-disease association. (HuGE Navigator)
17185385 Two independent cis-acting sites presumably influence risk for Guam neuro-degenerative disorders by regulating MAPT expression.
17179995 Data suggest that a probable cause variant may lie at or within close proximity to the rs242557 single nucleotide polymorphism as association with CSF tau levels seems to be primarily driven by rs242557 in a gene dosage-dependent manner.
17176091 While Lys-280 and Lys-281 play inhibitory roles in tau aggregation, Lys-311 is required for tau to assemble into fibrils.
17174556 haplotype increases both the expression of total MAPT transcript as well as specifically increasing the proportion of 4 microtubule binding repeat containing transcripts in Alzheimer disease
17172055 evidence of molecular interactions between prion protein (PrP) and tau protein highlights a potential role of tau in the biological function of PrP and the pathogenesis of TSEs
17169350 Beam walking tests revealed that tau transgenic rats developed progressive sensorimotor disturbances related to age; impaired reflex responses were another feature of behavioural phenotype in this novel transgenic rat.
17135279 Our result indicates that DYRK1A could be a key molecule bridging between beta-amyloid production and tau phosphorylation in AD.
17101697 These results suggest that a seminal cell biological event in Alzheimer's Disease pathogenesis is acute, tau-dependent loss of microtubule integrity caused by exposure of neurons to readily diffusible Abeta.
17085483 Data may explain the increased susceptibility of H1 carriers to neurodegeneration and suggest a potential mechanism between MAPT genetic variability and the pathogenesis of neurodegenerative disease.
17084815 The common occurrence of intracellular accumulations of TDP-43 supports the hypothesis that these disorders represent a clinicopathological entity of a single disease, and suggests that they can be newly classified as a proteinopathy of TDP-43.
17078951 GSK-3beta-catalyzed tau phosphorylation sites promoted by prephosphorylation by PKA
17072625 This study report the clinical, neuroimaging, cerebral spinal fluid biomarker, genetic, biochemical and postmortem neuropathological analyses of a case of familial FTD with a Leu266Val MAPT mutation.
17056594 soluble Abeta and tau, but not soluble Abeta alone, have roles in cognitive decline in transgenic mice with plaques and tangle
17045592 phosphorylation of tau at Thr231 and Ser262 by cdk5 plus GSK-3, which inhibits its normal biological activity, is regulated both by its amino terminal inserts and its physical state
17042504 N-terminal tau fragments inhibit human Tau polymerization by interacting with a specific C-terminal sequence, thereby stabilizing a soluble conformation of tau.
17029411 Three-dimensional heteronuclear NMR experiments demonstrate that the interaction with heparin induces beta-strand structure in several regions of Tau that might act as nucleation sites for its aggregation.
17028556 Glycogen synthase kinase 3 betais the missing link between the amyloid and tau-pathology in Alzheimer disease.
17023423 identify a region (positions 272-289) in the tau protein that, in the fibrillar state, either forms part of a core of parallel, in-register, beta-strands, or remains unfolded
17021754 Ubiquitin-positive and tau-negative inclusions in clinical phenotypes were noted in cases of frontotemporal dementia (FTD), progressive non-fluent aphasia, type 2 histology with semantic dementia, and type 3 histology with FTD, and motor neurone disease.
17008320 analysis of the role of microtubule binding repeats in tau aggregation and toxicity
16987883 recent work towards the unravelling of the functional basis of MAPT gene association with neurodegenrative disorders--review
16958643 In this review microtubule-associated tau is one protein that has important functions in healthy neurons, but forms insoluble deposits in diseases now known collectively as tauopathies.
16943417 SRp54 interacts with a purine-rich element tau in exon 10 and antagonizes Tra2beta, an SR-domain-containing protein that enhances exon 10 inclusion.
16939415 tau turnover is dependent on degradation by the proteasome (inhibited by MG132) in HT22 neuronal cells.
16930434 Results reveal that expression of a truncated variant form of tau protein leads to the accumulation of reactive oxygen species and sensitizes rat cortical neurons to cell death induced by oxidative stress.
16914144 Data show that the addition of tau to cultured neuroblastoma cells provoked an increase in the levels of intracellular calcium, which is followed by cell death.
16909000 Observational study of gene-disease association. (HuGE Navigator)
16909000 We found no evidence that could support a major pathogenic role of STH and TAU haplotype in AD, FTD or PD.
16908029 Results provide the first structural insights into a folded state of tau, and support a role for lipid membranes in mediating tau function and tau pathology.
16906164 Deletion of MAPT is associated with a common inversion polymorphism.
16906163 A gene deletion of MAPT at chromosome 17q21.3 is associated with developmental delay and learning disability.
16902761 The progressive axonal pathology is most consistent with a dying-back process caused by abnormal accumulation of tau in upstream neurons, while vacuolar myelinopathy may be a secondary manifestation of neuroinflammation.
16891100 Residues 305 to 335 are essential for in vitro tau fibrillization.
16879631 Transgenic mice expressing the FTDP-17-associated mutation P301L of tau display intact spatial working memory but impairment in spatial reference memory at 6 and 11 months of age as well as a modest disinhibition of exploratory behavior at 6 mos of age.
16877359 This mouse model therefore displays the main features of tau pathology and several of the pathophysiological disturbances observed during neurofibrillary degeneration.
16876320 Observational study of gene-disease association. (HuGE Navigator)
16876320 the age at onset showed significant correlation with the genotypes of Del-568TIns in PD samples when analyzed by Kendall rank correlation test. These results suggested that MAPT gene variants may modify the pathogenesis process of PD.
16875690 used tissue specific expression of wild type and mutant human tau transgenes to demonstrate differential phosphorylation and stability in a cell type-specific manner, which includes different neuronal types
16839689 Observational study of gene-disease association. (HuGE Navigator)
16818492 granular Tau aggregates have pathological roles in neuronal processes in tauopathies
16807328 Overexpression of mutant (P301L) human tau in CHIP-/- mice is insufficient to promote either argyrophilic or "pre-tangle" structures, despite marked phospho-tau accumulation throughout the brain.
16793187 Hyperphosphorylation of tau may be an underlying point of pathological convergence for several neuropsychiatric disorders, and prevention of tau hyperphosphorylation may be an important therapeutic target. (REVIEW)
16788822 Studies demonstrate that the full morphological phenotype of IBM including beta-amyloid and tau protein deposits may also develop in children, and that congenital muscle defects may lead to abnormal protein aggregation in IBM-like inclusions.
16781671 hyperphosphorylated-tau specific local phosphorylation patterns at Thr212/Ser214 and Thr231/Ser235 using monoclonal antibodies (mAb) generated against correspondingly modified peptides
16777844 A putative intronic splicing enhancer located in intron 10 of the tau gene is required for the splicing stimulatory activity of RBM4
16753151 biochemical analysis of neurofibrillary changes revealed that massive sarcosyl insoluble tau complexes consisted of human Alzheimer's tau
16738255 Targeted expression of tau in hippocampal slices provides a novel model to analyze tau modification and spatiotemporal dynamics of tau-dependent neurodegeneration.
16735465 These findings suggest that the nonfibrillized P-tau is most likely the responsible entity for the disruption of microtubules in neurons in Alzheimer's disease (AD).
16734669 APP is transported on vesicles distinct from the secretase components and amyloid-beta is not generated in transit when transport is blocked by tau
16717456 Microdeletions of this protein within the 17q21.31 segment should be considered as a possible cause of phenotypes resembling Angelman synrome.
16690493 A distinct isoform of abnormally phosphorylated tau (69 kDa, Tau 69) predominantly aggregates in laser-microdissected Pick bodies in sporadic Pick's disease.
16687396 site-specific phosphorylation and caspase cleavage of tau differentially affect the ability of tau to bind and stabilize microtubules and facilitate tau self-association
16678934 Cerebrospinal fluid levels of tau are significantly increased in patients with multiple system atrophy predominated by parkinsonism.
16651626 Suppressing the transgene (tau)prevented further neuronal loss without removing or preventing additional accumulation of neurofibrillary pathology.
16634634 Phosphorylation of serine and threonine residues in proline-rich sequences of tau protein induces a conformational change to a type II polyproline helix.
16609851 The composite Guam parkinsonism-dementia complex neuropathology profile of tau, alpha-synuclein and 8, 12-iso-iPF(2alpha)-VI isoprostane reported here more closely resembles that seen in other tauopathies including frontotemporal dementias (FTDs).
16606369 S422E tau is more resistant to proteolysis by caspase 3 than non-pseudophosphorylated tau. Tau phosphorylation at S422 may be a protective mechanism that inhibits cleavage in vivo.
16566606 Nitration of Tyr18, Tyr29, Tyr197, & Tyr394, events known to stabilize pathological Alz-50 conformation inhibits ability of monomeric tau to promote tubulin assembly. Alz-50 conformation may be mechanism through which tau nitration modulates MT stability.
16552760 Observational study of gene-disease association. (HuGE Navigator)
16503405 Sequencing the MAPT gene in affected individuals revealed a change in intron 9. This finding supports earlier studies on the effect of a splice-accepting element in inclusion of exon 10 in the MAPT transcript.
16487687 In DMI Tau exon 6 is mis-regulated only in the brain tissue.
16478768 The role of JNK activation in the hyperphosphorylation of abnormal tau protein during mitosis is reported.
16478530 Shift in the ratio of three-repeat tau and four-repeat tau mRNAs in individual cholinergic basal forebrain neurons in mild cognitive impairment and Alzheimer's disease
16477009 These findings unravel a cellular mechanism linking tau toxicity to NMDAR activation and might be relevant to Alzheimer's disease and tauopathies where NMDAR-mediated toxicity is postulated to play a pivotal role.
16475817 C-terminal end of tau folds over into vicinity of microtubule-binding repeat domain, N-terminus remains outside FRET distance of repeat domain, yet both ends of molecule approach one another.
16475161 PP2A-mediated dephosphorylation of HSP27 and tau correlated with PP2A-induced preservation of endothelial cell cytoskeleton
16464956 data show that chaperone induction results in the selective clearance of specific phospho-tau and conformationally altered tau species mediated by the proteasome
16464864 SUMO1 is involved in a modification of tau and alpha-synuclein that may also have implications for their pathogenic roles in neurodegenerative diseases
16456666 Abeta and hyperphosphorylated tau formation in somatostatin cells are basically independent events Decreased somatostatin only partly goes together with cytoskeletal changes in somatostatin cells in nucleus tuberalis lateralis of Alzheimer's disease.
16446437 Blocking the sites where amyloid-beta protein initially binds to tau might arrest the simultaneous formation of plaques and tangles in Alzheimer's disease
16443603 Tau is polyubiquitinated through Lys-48, Lys-11, and Lys-6 ubiquitin conjugation in Alzheimer's disease
16420965 Our results demonstrate that the flow cytometry-based method is a convenient tool to analyze the effect of GSK-3beta inhibitors on Tau phosphorylation.
16415175 Observational study of gene-disease association. (HuGE Navigator)
16410051 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16386371 In this work, we have found that in the presence of acetylsalicylic acid, at a concentration like that used for anti-inflammatory treatments, tau phosphorylation at serine 422 decreases.
16371011 Misregulation of alternative splicing of tau exon 10 seems to contribute to sporadic AD.
16362832 Familial autosomal dominant cortico-basal degeneration with the P301S mutation in the tau gene.
16362633 Observational study of gene-disease association. (HuGE Navigator)
16315267 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16251138 A Degeneration, Frontotemporal Lobar patient at-risk status for the +16 exon 10 splice mutation in the tau gene (microtubule associated protein tau, MAPT), which had given rise to progressive behavioural disturbances in two of his siblings.
16246844 analysis of tau repeat domain in a model of tauopathy
16240366 the phenotype observed in affected individuals from P301S MAPT mutation families is heterogeneous and is broader than the phenotypes seen to date in affected family members carrying other MAPT mutations
16226838 Human protein tau inhibits DNA replication.
16226718 Abeta(42)-mediated decrease in tau solubility depends on the interplay of distinct phospho-epitopes of tau and not only on phosphorylation of the S422 epitope
16225961 Cu2+ plays an important role in the aggregation of R2 peptide (derived from the second repeat region of tau protein) and tau protein and that copper binding to R2 peptide may be another possible involvement in AD.
16221853 Accumulation of tau in transgenic mice expressing human tau exclusively in oligodendrocytes causes neurodegeneration by disrupting axonal transport
16195395 High-density SNP haplotyping suggests altered regulation of tau gene expression in progressive supranuclear palsy.
16182262 These results suggest that R406W tau Tg mice exhibit changes in depression-related behavior involving serotonergic neurons and provide an animal model for investigating AD with depression.
16176937 The axonal transport of tau occurs via a mechanism utilising fast transport motors, including the kinesin family of proteins, and that alpha-synuclein transport in neurons may involve both kinesin and dynein motor proteins.
16165272 Our study indicates that the apoE epsilon4 carrier status should be considered when CSF P-tau(231P) is evaluated as biomarker candidate of AD in MCI subjects.
16157753 A new mutation of the tau gene, G303V, in early-onset familial progressive supranuclear palsy.
16129700 Abeta but not tau is deregent-insoluble early in the pathogenesis of Alzheimer's disease
16125396 These findings challenge the idea that tau pathology in Alzheimer's disease is merely a downstream effect of amyloid production/deposition and suggest that reciprocal interactions between beta-amyloid and tau alterations may take place in vivo.
16115884 the Fyn-tau interaction has a role in neurodegeneration
16114883 This novel yeast model recapitulates hyperphosphorylation, conformation, and aggregation of protein tau and provides insight in molecular changes crucial in tauopathies.
16042549 H2 haplotype is derived from Homo neanderthalensis and entered H. sapiens populations during the co-existence of these species in Europe from approx. 45000 to 18000 years ago. (review)
16023860 Our results demonstrate that tau over-expression in vivo cause a synaptic dysfunction, which may be caused by a reduced complement of functional mitochondria.
16020737 after the suppression of transgenic tau in mice with progressive age-related neurofibrillary tangles, memory function recovered
16014719 Tyr-18 was the major site for Fyn phosphorylation, but Tyr-394 was the main residue for Abl. Phosphorylation of tau on Tyr-394 is a physiological event that is potentially part of a signal relay
16005901 Observational study of gene-disease association. (HuGE Navigator)
16005901 The studied tau genotype may contribute to the multifactorial genetic background of ALS.
16000144 CaM kinase II is involved in the accumulation of tau in neuronal soma in Alzheimer's disease brain.
15997419 The levels of t-tau and p-tau were higher in MS patients than in controls; however, increased levels were not related to the clinical activity of the disease.
15994305 Mutations do not affect the phosphorylatability of FTDP-17 tau by Cdk5 complexed with p35, p25, or p39
15975068 Observational study of genotype prevalence. (HuGE Navigator)
15973541 These data suggest that several species of tau are variably phosphorylated at a given time in a given region (and probably in a given cell), and that tau aggregates are composed of several phosphorylated truncated or cleaved tau molecules.
15963990 The seventh residue of the second and third repeat fragments (R2 and R3 peptides) of the microtubule-binding domain (MBD)is very important for tau filamentous assembly.
15963640 These data indicate that 14-3-3zeta may not be directly interacting with GSK3beta and tau in the brain, but may indirectly facilitate the interactions by binding to other proteins.
15950767 This study indicates that post-translational events are likely to be the main factors controlling tau isoform composition in sporadic tauopathies and highlights the benefit of quantitative RT-PCR in the assessment of splicing abnormalities in tauopathies.
15940384 Familial frontotemporal dementia associated with the novel MAPT mutation T427M.
15878580 tau genotype does not influence the disease course, however, may predispose to a specific clinical sign in the early stage of FTDP-17 frontotemporal dementia Parkinsonism
15869817 analysis of phosphopeptides related to the human tau protein
15855649 In both primary hippocampal neurons and mice, the tau-induced Golgi apparatus (GA) fragmentation was not caused by apoptosis. Tau implicated in GA fragmentation. This occurs before formation of neurofibrillary tangles.
15855160 analysis of tau binding sites important for beta-structure and for binding to microtubules and polyanions
15848182 abnormal nitration of tau contributes to the impaired biological activity of tau in binding to the microtubules, implying a novel mechanism responsible for the neurodegeneration seen in AD brain
15823754 In Alzheimer's disease, phosphorylated tau protein, the major component of neurofibrillary tangles, is considered a central mediator of disease pathogenesis.
15823045 the aggregation of recombinant full-length four-repeat tau (htau40) was examined in vitro under near-physiological conditions using transmission electron microscopy and spectroscopy methods
15795929 These results obtained in vitro and in vivo demonstrate that endogenous tau is not normally degraded by the proteasome.
15792962 underlying variations in MAPT could contribute to disease pathogenesis by subtle effects on gene expression and/or splicing
15765246 novel missense mutation in exon 12 of the tau gene, G335V, in a German family with frontotemporal dementia of early age at onset, in the third decade of life
15750210 tau FTDP-mutation N279K is implicated in dementias.
15746184 results demonstrate that glyceraldehyde-3-phosphate dehydrogenase, a glycolytic and microtubule binding protein, co-localized to neurofibrillary tangles and immunoprecipitated with paired helical filament-tau
15733856 a mechanism through which site-specific posttranslational modifications can modulate filament accumulation at low free intracellular tau concentrations
15732111 Observational study of gene-disease association. (HuGE Navigator)
15732111 was an increased risk of PD for persons with either SNCA 261/261 or MAPT H1/H1 genotypes as compared with persons with neither. The combined effect of the two genotypes was the same as for either of the genotypes alone (separate and equal).
15721985 4-hydroxy-2-nonenal modifications of tau promote and contribute to the generation of the major conformational properties defining neurofibrillary tangles
15671021 Results suggest that tau causes a conformational shift in microtubules resulting in altered dynamics.
15652510 the initial structural moiety and its structural feature necessary for starting the tau paired helical filament formation of tau
15638805 The conformation of the tau protein was studied because of its importance in maintaining the shape of the axon.
15627775 Meta-analysis of gene-disease association. (HuGE Navigator)
15627775 Our results support the notion that tau gene H1 haplotype may be an important risk factor of PD.
15596612 Data are compatible with the notion that tau aggregates predispose neurons to develop secondary Lewy bodies.
15570502 Observational study of gene-disease association. (HuGE Navigator)
15546861 tau is probably a physiological substrate of protein phosphatase 5 (PP5) and that the abnormal hyperphosphorylation of tau in Alzheimer disease might result in part from the decreased PP5 activity in the diseased brains
15542598 possible role for thrombin in proteolysis of tau under physiological and/or pathological conditions in human brains
15532542 Neuronal tau non-specifically functions in a chaperone-like manner towards the enzymes of carbohydrate metabolism, e.g., lactate dehydrogenase.
15525651 tau phosphorylation and PP2A activity are regulated by Galpha12
15509534 a mutant human tau protein causes induction of inflammatory mediators and microglial activation in the mouse model
15477533 Observational study of gene-disease association. (HuGE Navigator)
15475684 These results indicate that the patterns of the tau epitopes represented by this panel that reside in the pathological aggregates of PSP and CBD are similar to each other but distinct from that of AD.
15464261 Observational study of genotype prevalence. (HuGE Navigator)
15459824 Tau H1 contains an important susceptibility allele contributing to increased risk of neurodegeneration
15385569 beta-amyloid and tau-bearing skeletal myotubes show calcium dyshomeostasis
15376481 Observational study of gene-disease association. (HuGE Navigator)
15376481 mutations in this gene are not a frequent cause of the frontotemporal dementia phenotype in Canadian patients.
15372253 Observational study of genotype prevalence. (HuGE Navigator)
15365985 Review. 34 different pathogenic MAPT mutations in 101 families have been described & their differing phenotypes characterized. In vitro & transgenic studies show their effect on tau function. Tau's role in dementia is discussed.
15356202 As Alzheimer tablges evolve, the extreme N terminus of tau is lost & a C-terminal caspase-truncated epitope lacking AA 422-441 appears. Caspase-6 cleaved the N terminus of tau in vitro at D13, a semicanonical, undescribed caspase cleavage site in tau.
15297935 Observational study of gene-disease association. (HuGE Navigator)
15293277 Observational study of gene-disease association. (HuGE Navigator)
15283964 in primary cultures, Akt selectively phosphorylates tau at S214 rather than T212 so tau S214 may participate in Akt-mediated anti-apoptotic signaling.
15266787 Strong genetic evidence for the involvement of tau gene variability in the pathogenesis of progressive supranuclear palsy (PSP) has been demonstrated in several Caucasian populations and is discussed in this review.
15249677 Results reveal a mechanism of regulation of tau phosphorylation and suggest that abnormal hyperphosphorylation of tau could result from decreased tau O-GlcNAcylation, which may be induced by deficient brain glucose uptake/metabolism.
15240881 filament growth wherein the existing filament serves as a template for the incoming, unfolded tau molecule, resulting in a new structured layer with maximized hydrogen-bonded contact surface and side-chain stacking.
15228592 We show that c-Jun N-terminal kinases JNK1 JNK2 and JNK3 phosphorylate tau at many serine/threonine-prolines; these findings extend the number of candidate protein kinases for tau hyperphosphorylation in Alzheimer's disease and neurodegenerative disorders
15228591 A novel Tau isoform localizes differently from canonical Tau in SH-SY5Y cells which stably overexpress it. In both normal and Alzheimer's hippocampus it is in dentate gyrus granular cells and CA1/CA3 pyramidal cells, not with Tau but partly with MAP2
15201350 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15198676 we generated a series of constructs with intron deletions from full length tau exons 9-11. A minimum distance requirement between exon 10 and 11 for correct splicing was noted. SRp20 facilitates exon10 exclusion and FTDP-17 mutant exon 10 skipping
15178951 Staining for tau was negative in 5 of the frontal-lobe degeneration cases and faintly positive in 1, but positive in all Alzheimer's disease cases.
15178932 Hereditary frontotemporal dementia and parkinsonism linked to chromosome 17 caused by mutations in the tau gene shows a wide range in age at onset, several distinct clinical presentations, and a spectrum of tau pathology. Review.
15178931 Frontotemporal lobar degeneration can result from mutations in tau gene on chromosome 17. Brains with tau mutations accumulate insoluble tau within neurons and glia. Two new tau mutations may cause disease in absence of tau accumulation. Review.
15140937 Human mutant R406W tau transgenic mice developed an age-dependent accumulation of insoluble filamentous tau aggregates in neuronal perikarya of the cerebral cortex, hippocampus, cerebellum, and spinal cord
15126504 Tau phosphorylation is induced in vitro by down-regulation of WW domain-containing oxidoreductase
15115761 We show that the entire, fully extended H1 haplotype is associated with progressive supranuclear palsy, which implicates several other genes in addition to MAPT, as candidate pathogenic loci
15106853 Observational study of gene-disease association. (HuGE Navigator)
15106853 In a case-control study a novel polymorphism in the tau gene (IVS11+ 90G-->A) shows significant association between possession of the A allele of tau and male Japanese Alzheimer's disease with early-onset.
15096589 reversible binding occurs between tau and the surface of preassembled microtubules, whereas irreversible binding results when tau is coassembled with tubulin into a tau-microtubule copolymer
15083285 Both in multiple sclerosis and other inflammatory neurological diseases, tau protein levels in the cerebrospinal fluid (csf) are significantly higher than in csf samples from non-inflammatory neurological diseases.
15075227 In cells transfected with human tau, mitochondrial clustering was found in cells in which tau was unphosphorylated
15053964 Evidence is provided for the first time that olfactory dysfunction is present in a transgenic mouse model of neurodegenerative tauopathy, including the filamentous tau tangles seen in Alzheimer's disease.
15034924 Expression of one particular tau isoform which contain exon 6, significantly inhibits neurite elongation in neuroblastoma cells .
15020716 Both 3- and 4-repeat tau isoforms suppressed microtubule dynamics, though to different extents.
15009664 we reconstituted naturally occurring exon 10 FTDP mutants and classified their effects on its splicing. We also carried out a survey of the influence of splicing regulators on Tau exon 10 inclusion and tentatively identified the site of action for several
15004327 Increase of soluble Abeta42 and Abeta40 in FTDP-17, compared to normal and DLDH brains, both of which had comparable levels of Abeta species.Immunoreactivity of the intracellular Abeta42 was increased in cortical neurons of subjects with FTDP-17.
14999081 Tyrosine phosphorylated tau is distributed in Alzheimer disease brain differently from other phosphorylated tau. Evidence of differentially phosphorylated tau within degenerating neurons was found supporting a role for fyn in neurodegeneration
14993907 Overexpression of human tau in Drosophila larvae disrupts axonal transport causing vesicle aggregation and this is associated with loss of locomotor function.
14991828 This study found exon 9 to 13 of the tau gene have deletation of the conserved asparagin 296.
14991810 an increase in expression of the MAPT gene is a susceptibility factor in idiopathic PD.
14967043 NMR spectroscopy and fluorescence mapping demonstrate that the epitope centered around the phospho-Thr212-Pro213 motif of Tau is a newly recognized Pin1 prolyl cis/trans-isomerase interaction site.
14966169 Observational study of gene-disease association. (HuGE Navigator)
14963027 tau binds to heat shock protein 27, leading to decreased concentration of hyperphosphorylated tau and enhanced cell survival
14769048 It is proposed that the progression from amorphous aggregation of tau through intermediate formation and fibrillization may underlie the activity of other inducers such as hyperphosphorylation and may be operative in vivo.
14769047 Structure of tau from Alzheimer brain paired helical filaments is based on beta structure embedded in an environment of unstructured protein with no measurable indication of alpha-helical structure, thus it can be classifed as "amyloid" in a broad sense.
14761950 Casein kinase 1 delta phosphorylates tau at sites that modulate tau/microtubule binding
14730711 Tau, modified after ischemia, undergoes a reversible conformational change on Triton-X exposure. Because conformation at Ser101 of bovine tau is crucial for its affinity to tau2, this Ser-like conformation mimicked by its human counterpart.
14660557 results indicate that in an appropriate cellular context R406W tau is hyperphosphorylated, which leads to decreased microtubule binding
14627651 Overexpressing the longest human tau isoform in rat astrocytes resulted in increases in tubulin biosynthesis and the accumulation of acetylated, tyrosinated, alpha- and beta-tubulin
14615799 novel, physiological role of the N-terminal domain of tau, but also underlay that its possible proteolytic truncation mediated by apoptotic proteases may generate a highly toxic fragment that could contribute to neuronal death
14612456 tau binds to Hsc70, and its phosphorylation is a recognition requirement for the addition of ubiquitin
14600827 Observational study of gene-disease association. (HuGE Navigator)
14572459 A novel mechanism of apoptotic cell death is suggested in mutant TauP301L (but not in wild-type)-expressing cells that involves survivin-mediated activation of cell cycle checkpoint.
14523627 CSF-tau was a useful biological marker to discriminate Alzheimer's disease from normal aging, neurological and psychiatric disorders.
14503643 The presence of filamentous tau protein in the frontal cortex of these patients suggests a possible link between tau and the genetic defect present on chromosome 3 and associated with FTD-3.
12975285 Observational study of gene-disease association. (HuGE Navigator)
12937143 Nitrative injury is directly linked to the formation of filamentous tau inclusions.
12932819 Observational study of gene-disease association. (HuGE Navigator)
12925374 Observational study of genotype prevalence. (HuGE Navigator)
12888622 tau is proteolyzed by multiple caspases at a highly conserved aspartate residue (Asp421) in its C terminus in vitro in neurons in Alzheimer's disease
12883828 L266V is a pathogenic tau mutation that is associated with Pick-like pathology.
12872001 expressed normal and FTDP-17 mutant human tau (mutations P301L and V337M) in Caenorhabditis elegans to model tauopathy disorders
12853572 native filaments from brain and filaments assembled in vitro from expressed tau protein have a clear cross-beta structure
12847166 The authors describe a case of clinically diagnosed young onset progressive supranuclear palsy (PSP) with symptom onset at 40 years of age, no family history and tau exon 10 +16 mutation (MAPT, IVS10, C-U, +16)
12826737 Observational study of gene-disease association. (HuGE Navigator)
12826737 MAPT mutations are not connected with most of the frontotemporal dementia cases in the Polish population.
12811584 In this study the presence of tau and 14-3-3 proteins in GCIs of 21 patients with MSA was investigated.
12796837 Frontotemporal dementia and parkinsonism with the P301S tau gene mutation in a Jewish family.
12765608 cdk5 can initiate a major impact on tau pathology progression that probably involves several kinases.
12756133 Observational study of gene-disease association. (HuGE Navigator)
12756133 Sequence variations in intronic or regulatory regions of tau may have previously unrecognized consequences leading to tau dysfunction and neurodegeneration.
12714745 results suggest that interactions between alpha-synuclein and tau can promote their fibrillization and drive the formation of pathological inclusions in human neurodegenerative diseases
12710929 A positive association between the H1 haplotype and frontotemporal dementia was found, consistent with the hypothesis that the tau gene, or nearby gene on the H1 haplotype, is a risk factor for frontotemporal dementia
12678504 This protein binds to DNA but not single-stranded DNA.
12649279 results implicate the human tau gene as a target gene for the alternative splicing regulator Tra2 beta protein, suggesting that Tra2 beta may play a role in aberrant tau exon 10 alternative splicing
12641733 Paired helical filament-tau inhibits proteasome activity in Alzheimer disease brain
12629248 Significant overrepresentation of the tau H1/H1 genotype, also found in progressive supranuclear palsy and corticobasal degeneration, was found in the primary progresssive aphasia group.
12590615 The interaction of the amino terminus of tau with its microtubule-binding repeat regions, creating a conformation similar to that recognized by the monoclonal antibody Alz50, is very likely a propolymerization state of the tau molecule.
12573250 can prevent DNA from thermal denaturation, improve renaturation and protect DNA from damage induced by free radicals
12565146 Observational study of genotype prevalence. (HuGE Navigator)
12527113 Tau isoforms are O-GlcNAc modified (a marker of healthy brain Tau) and a balance occurs between phosphorylation, glycosylation and nuclear localization
12505985 Repeat motifs of this protein bind to the insides of microtubules in the absence of taxol
12492138 The phenotype of pallidopontonigral degeneration (PPND) resulting from N279K mutation of tau includes dysfunction of the autonomic nervous system, correlating with the duration of illness and clinical and functional severity of parkinsonism.
12476321 This is a possible candidate gene in frontal lobe dementia.
12470988 REVIEW: tau dysfunction can lead to neurodegeneration and the development of clinical symptoms
12464279 two phosphorylation sites (serines 262 and 356) were identified in the tubulin binding sites. When tau was phosphorylated by CaM kinase II, the binding of tau to taxol-stabilized microtubules was remarkably impaired.
12387894 phosphorylation by cdk5 and GSK-3beta
12368474 Expression of mutant human tau isoform in transgenic mice resulted in the development of congophilic hyperphosphorylated tau inclusions in forebrain neurons.
12368187 biochemical analysis in argyrophilic grain disease, Alzheimer's disease, and Pick's disease
12231446 Observational study of gene-disease association. (HuGE Navigator)
12220379 Observational study of genotype prevalence. (HuGE Navigator)
12212558 Observational study of gene-disease association. (HuGE Navigator)
12212558 no evidence seen for association of tau gene polymorphism with transmissible spongiform encephalopathies
12198126 new insights into the conformation of tau in the soluble state and after incorporation into paired helical filaments
12177374 In aging and sporadic Alzheimer's disease, severe tau pathology (stage 7 to stage 10) correlates well with a huge and widespread Abeta burden.
12144513 Results suggest that binding of tau to DNA occurs in an aggregation-dependent, and a phosphorylation-independent, manner.
12112079 Pick's disease is characterized by accumulation of Pick bodies in the hippocampus and cortex, and by the presence of microtubule-binding repeat tau pathology in gray and white matter, distinguishing this tauopathy from other neurodegenerative disorders.
12082079 These results provide strong evidence suggesting that MAP2c and tau stabilize microtubules by binding along individual protofilaments, possibly by bridging the tubulin interfaces.
12070658 Concurrence of alpha-synuclein and tau brain pathology in the Contursi kindred.
12056929 Observational study of gene-disease association. (HuGE Navigator)
12032355 Observational study of gene-disease association. (HuGE Navigator)
12000767 additional regulatory sequences rugulating tau exon 10 splicing
11988340 Observational study of gene-disease association. (HuGE Navigator)
11959919 Tau is essential to beta -amyloid-induced neurotoxicity
11959122 Modelling Alzheimer-specific abnormal Tau phosphorylation independently of GSK3beta and PKA kinase activities.
11958849 Observational study of gene-disease association. (HuGE Navigator)
11958849 The tau H1 haplotype is associated with increased risk of Parkinson disease in a Norwegian population.
11939896 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11861703 This suggests that usually FTDP-17 and PSP, including the rare familial form of PSP, are likely to be separate conditions and that usually PSP and typical PSP-like syndromes are not due to mutations in tau.
11852060 The glycosylation of tau is an early abnormality that can facilitate the subsequent abnormal hyperphosphorylation of tau in Alzheimer's disease brain.
11837744 Specific tau phosphorylation sites correlate with severity of neuronal cytopathology in Alzheimer's disease.
11831556 a biomarker for Alzheimer disease
11831025 Associated with etilogical mechanism of Alzheimer's disease.
11706972 Observational study of gene-disease association. (HuGE Navigator)
11698154 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
11391737 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
11303757 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11255441 Observational study of gene-disease association. (HuGE Navigator)
11166961 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTP      1 - 70
TAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREP     71 - 140
GPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEGPPLKGAGGKE    141 - 210
RPGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIP    211 - 280
ASEPDGPSVGRAKGQDAPLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEAD    281 - 350
LPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS    351 - 420
DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQKGQANATRIPA    421 - 490
KTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRL    491 - 560
QTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPV    561 - 630
DLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAK    631 - 700
AKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL                701 - 758
//

Text Mined References (1266)

PMID Year Title
27306859 2016 Tau physiology and pathomechanisms in frontotemporal lobar degeneration.
27129267 2016 The Dynamics and Turnover of Tau Aggregates in Cultured Cells: INSIGHTS INTO THERAPIES FOR TAUOPATHIES.
27118310 2016 Tau mutant A152T, a risk factor for FTD/PSP, induces neuronal dysfunction and reduced lifespan independently of aggregation in a C. elegans Tauopathy model.
27100392 2016 Characterization of Movement Disorder Phenomenology in Genetically Proven, Familial Frontotemporal Lobar Degeneration: A Systematic Review and Meta-Analysis.
27030011 2016 Extracellular Vesicles Isolated from the Brains of rTg4510 Mice Seed Tau Protein Aggregation in a Threshold-dependent Manner.
27023670 2016 Stabilization of Microtubule-Unbound Tau via Tau Phosphorylation at Ser262/356 by Par-1/MARK Contributes to Augmentation of AD-Related Phosphorylation and A?42-Induced Tau Toxicity.
26916334 2016 Age-dependent neuroinflammation and cognitive decline in a novel Ala152Thr-Tau transgenic mouse model of PSP and AD.
26903089 2016 Isomerization and Oligomerization of Truncated and Mutated Tau Forms by FKBP52 are Independent Processes.
26876913 2016 Cognitive impairment in late-life bipolar disorder is not associated with Alzheimer's disease pathological signature in the cerebrospinal fluid.
26852117 2016 Multiple signaling factors and drugs alleviate neuronal death induced by expression of human and zebrafish tau proteins in vivo.
26824039 2016 The Microtubule-Associated Protein Tau and Its Relevance for Pancreatic Beta Cells.
26751496 2016 Nuclear Tau and Its Potential Role in Alzheimer's Disease.
26751494 2016 Characteristics of Tau and Its Ligands in PET Imaging.
26751493 2016 Tau Protein Hyperphosphorylation and Aggregation in Alzheimer's Disease and Other Tauopathies, and Possible Neuroprotective Strategies.
26742856 2016 Tau Protein Quantification in Human Cerebrospinal Fluid by Targeted Mass Spectrometry at High Sequence Coverage Provides Insights into Its Primary Structure Heterogeneity.
26712030 2016 Protein structural and surface water rearrangement constitute major events in the earliest aggregation stages of tau.
26704708 2016 Caspase-cleaved tau exhibits rapid memory impairment associated with tau oligomers in a transgenic mouse model.
26701291 2016 Obesity, diabetes, and leptin resistance promote tau pathology in a mouse model of disease.
26682901 2016 Total-tau and neurofilament light in CSF reflect spinal cord ischaemia after endovascular aortic repair.
26655856 2016 Proline Conformation in a Functional Tau Fragment.
26621125 2016 The neuronal extracellular matrix restricts distribution and internalization of aggregated Tau-protein.
26608845 2015 Rescue from tau-induced neuronal dysfunction produces insoluble tau oligomers.
26601739 2016 Variants in GBA, SNCA, and MAPT influence Parkinson disease risk, age at onset, and progression.
26581847 2016 Biochemical and Behavioral Evaluation of Human MAPT Mutations in Transgenic Drosophila melanogaster.
26576485 2016 Neuronal expression of pathological tau accelerates oligodendrocyte progenitor cell differentiation.
26556772 2016 Is phosphorylated tau unique to chronic traumatic encephalopathy? Phosphorylated tau in epileptic brain and chronic traumatic encephalopathy.
26542680 2015 Direct force measurements reveal that protein Tau confers short-range attractions and isoform-dependent steric stabilization to microtubules.
26540742 2015 Performance of transgenic TgTau-P301L mice in a 5-choice serial reaction time task (5-CSRTT) as a model of Alzheimer's disease.
26538150 2016 Biochemical classification of tauopathies by immunoblot, protein sequence and mass spectrometric analyses of sarkosyl-insoluble and trypsin-resistant tau.
26534959 2015 HIV-1-Tat Protein Inhibits SC35-mediated Tau Exon 10 Inclusion through Up-regulation of DYRK1A Kinase.
26473392 2015 Distinct clinical and pathological phenotypes in frontotemporal dementia associated with MAPT, PGRN and C9orf72 mutations.
26444794 2016 MAPT H1 Haplotype is Associated with Late-Onset Alzheimer's Disease Risk in APOE?4 Noncarriers: Results from the Dementia Genetics Spanish Consortium.
26426266 2015 A Novel Tau Mutation in Exon 12, p.Q336H, Causes Hereditary Pick Disease.
26408675 2015 Predictive and Prognostic Value of the TauProtein in Breast Cancer.
26403791 2016 Behind the curtain of tauopathy: a show of multiple players orchestrating tau toxicity.
26402096 2015 Identification of Novel Tau Interactions with Endoplasmic Reticulum Proteins in Alzheimer's Disease Brain.
26381172 2015 Effects of lysine residues on structural characteristics and stability of tau proteins.
26373282 2015 Frontotemporal dementia-associated N279K tau mutant disrupts subcellular vesicle trafficking and induces cellular stress in iPSC-derived neural stem cells.
26363795 2016 The Role of MAPT in Neurodegenerative Diseases: Genetics, Mechanisms and Therapy.
26333800 2015 Role for the microtubule-associated protein tau variant p.A152T in risk of ?-synucleinopathies.
26330509 2015 A Brief History of Tau.
26297556 2015 Closing the tau loop: the missing tau mutation.
26269332 2015 The Human Tau Interactome: Binding to the Ribonucleoproteome, and Impaired Binding of the Proline-to-Leucine Mutant at Position 301 (P301L) to Chaperones and the Proteasome.
26268594 2015 LRRK2 Facilitates tau Phosphorylation through Strong Interaction with tau and cdk5.
26258756 2015 Reduced miR-512 and the Elevated Expression of Its Targets cFLIP and MCL1 Localize to Neurons With Hyperphosphorylated Tau Protein in Alzheimer Disease.
26237304 2015 Peripheral Total Tau in Military Personnel Who Sustain Traumatic Brain Injuries During Deployment.
26220942 2015 Early maturation and distinct tau pathology in induced pluripotent stem cell-derived neurons from patients with MAPT mutations.
26200045 2015 [A Pair of Siblings with a rare R5H-Mutation in Exon 1 of the MAPT-Gene].
26198711 2016 Sex hormone-related neurosteroids differentially rescue bioenergetic deficits induced by amyloid-? or hyperphosphorylated tau protein.
26177386 2015 RNA Binds to Tau Fibrils and Sustains Template-Assisted Growth.
26176913 2015 Antibody against early driver of neurodegeneration cis P-tau blocks brain injury and tauopathy.
26170022 2015 Regulation of human MAPT gene expression.
26165593 2015 Structural Impact of Tau Phosphorylation at Threonine 231.
26161867 2015 Caspase-Cleaved Tau Co-Localizes with Early Tangle Markers in the Human Vascular Dementia Brain.
26143746 2015 Distinct Neurodegenerative Changes in an Induced Pluripotent Stem Cell Model of Frontotemporal Dementia Linked to Mutant TAU Protein.
26134402 2015 Identification of key amino acids responsible for the distinct aggregation properties of microtubule-associated protein 2 and tau.
26119563 2015 Stimulation of EphB2 attenuates tau phosphorylation through PI3K/Akt-mediated inactivation of glycogen synthase kinase-3?.
26103986 2015 Involvement of 14-3-3 in tubulin instability and impaired axon development is mediated by Tau.
26086902 2015 Homozygous MAPT R406W mutation causing FTDP phenotype: A unique instance of a unique mutation.
26083267 2016 Protein aggregate formation in oligodendrocytes: tau and the cytoskeleton at the intersection of neuroprotection and neurodegeneration.
26077951 2015 Genome-wide association study of corticobasal degeneration identifies risk variants shared with progressive supranuclear palsy.
26034266 2015 Tau stabilizes microtubules by binding at the interface between tubulin heterodimers.
25998110 2015 The frontotemporal dementias.
25982997 2015 Inefficient induction and spread of seeded tau pathology in P301L mouse model of tauopathy suggests inherent physiological barriers to transmission.
25974414 2015 Role of the Tau N-terminal region in microtubule stabilization revealed by new endogenous truncated forms.
25963821 2015 Tau reduction prevents A?-induced axonal transport deficits by blocking activation of GSK3?.
25960998 2015 SNCA Gene, but Not MAPT, Influences Onset Age of Parkinson's Disease in Chinese and Australians.
25959626 2015 Wnt co-receptor LRP5/6 overexpression confers protection against hydrogen peroxide-induced neurotoxicity and reduces tau phosphorylation in SH-SY5Y cells.
25953777 2015 The role of tau in the pathological process and clinical expression of Huntington's disease.
25930997 2015 Essential role of POLDIP2 in Tau aggregation and neurotoxicity via autophagy/proteasome inhibition.
25918155 2015 Truncation and Activation of Dual Specificity Tyrosine Phosphorylation-regulated Kinase 1A by Calpain I: A MOLECULAR MECHANISM LINKED TO TAU PATHOLOGY IN ALZHEIMER DISEASE.
25912737 2015 Sequence-dependent abnormal aggregation of human Tau fragment in an inducible cell model.
25908520 2015 [The testicular microtubule-associated protein Tau: Where, when during spermatogenesis?].
25900293 2015 A novel tau mutation, p.K317N, causes globular glial tauopathy.
25899925 2015 Parkinson's disease-associated PINK1 G309D mutation increases abnormal phosphorylation of Tau.
25895963 Serum tau protein as a marker of disease activity in enterohemorrhagic Escherichia coli O111-induced hemolytic uremic syndrome.
25887395 2015 Tau Trimers Are the Minimal Propagation Unit Spontaneously Internalized to Seed Intracellular Aggregation.
25886404 2015 Proteinase-activated receptor 2 and disease biomarkers in cerebrospinal fluid in cases with autopsy-confirmed prion diseases and other neurodegenerative diseases.
25882706 2015 The active Hsc70/tau complex can be exploited to enhance tau turnover without damaging microtubule dynamics.
25881209 2015 Analysis of tau post-translational modifications in rTg4510 mice, a model of tau pathology.
25880550 2015 APOE ?4 moderates abnormal CSF-abeta-42 levels, while neurocognitive impairment is associated with abnormal CSF tau levels in HIV+ individuals - a cross-sectional observational study.
25863528 2015 Human tau expression reduces adult neurogenesis in a mouse model of tauopathy.
25863267 2015 A strategy focused on MAPT, APP, NCSTN and BACE1 to build blood classifiers for Alzheimer's disease.
25847153 2015 Downregulation of the microtubule associated protein tau impairs process outgrowth and myelin basic protein mRNA transport in oligodendrocytes.
25842390 2015 HS3ST2 expression is critical for the abnormal phosphorylation of tau in Alzheimer's disease-related tau pathology.
25826665 2015 Structural determinants for alternative splicing regulation of the MAPT pre-mRNA.
25822823 2015 Expression of 1N3R-Tau isoform inhibits cell proliferation by inducing S phase arrest in N2a cells.
25804954 2015 Lack of exacerbation of neurodegeneration in a double transgenic mouse model of mutant LRRK2 and tau.
25791428 2015 mTor mediates tau localization and secretion: Implication for Alzheimer's disease.
25773385 2015 Predictive value of microtubule-associated protein Tau in patients with recurrent and metastatic breast cancer treated with taxane-containing palliative chemotherapy.
25772164 2015 Intraneuronal accumulation of misfolded tau protein induces overexpression of Hsp27 in activated astrocytes.
25765123 2015 Dominant frontotemporal dementia mutations in 140 cases of primary progressive aphasia and speech apraxia.
25725586 2015 Tau and PTEN status as predictive markers for response to trastuzumab and paclitaxel in patients with HER2-positive breast cancer.
25691742 2015 Regulation and aggregation of intrinsically disordered peptides.
25687773 2015 Genetic overlap between Alzheimer's disease and Parkinson's disease at the MAPT locus.
25687137 2015 NH2-truncated human tau induces deregulated mitophagy in neurons by aberrant recruitment of Parkin and UCHL-1: implications in Alzheimer's disease.
25659102 2015 PE859, a novel tau aggregation inhibitor, reduces aggregated tau and prevents onset and progression of neural dysfunction in vivo.
25658796 2015 Three-dimensional collagen type I matrix up-regulates nuclear isoforms of the microtubule associated protein tau implicated in resistance to paclitaxel therapy in ovarian carcinoma.
25620700 2015 A genome-wide gene-expression analysis and database in transgenic mice during development of amyloid or tau pathology.
25588407 2015 Validation of AD-CSF-Index in Chinese patients with Alzheimer's disease and nondemented controls.
25577413 2015 Association between MAPT haplotype and memory function in patients with Parkinson's disease and healthy aging individuals.
25575131 2015 Tau proteins in the temporal and frontal cortices in patients with vascular dementia.
25574843 2015 Dysregulation of microRNA-219 promotes neurodegeneration through post-transcriptional regulation of tau.
25574752 2014 Frontotemporal lobar degeneration with MAPT mutation in an Italian-Polish family. A case report.
25573097 2015 Thr175-phosphorylated tau induces pathologic fibril formation via GSK3?-mediated phosphorylation of Thr231 in vitro.
25524708 2015 Temporally distinct phosphorylations differentiate Tau-dependent learning deficits and premature mortality in Drosophila.
25476420 2014 Direct cellular delivery of human proteasomes to delay tau aggregation.
25468336 2014 A refined reaction-diffusion model of tau-microtubule dynamics and its application in FDAP analysis.
25465240 2016 Olfactory Deprivation Hastens Alzheimer-Like Pathologies in a Human Tau-Overexpressed Mouse Model via Activation of cdk5.
25443551 2015 Three sib-pairs of autopsy-confirmed progressive supranuclear palsy.
25436420 2015 The green tea polyphenol (-)-epigallocatechin gallate prevents the aggregation of tau protein into toxic oligomers at substoichiometric ratios.
25424384 2015 Biomarkers in the Diagnosis and Prognosis of Alzheimer's Disease.
25416970 2015 Toxic tau aggregation in AD.
25406315 2015 Conformation determines the seeding potencies of native and recombinant Tau aggregates.
25394490 2015 GSK-3? dysregulation contributes to parkinson's-like pathophysiology with associated region-specific phosphorylation and accumulation of tau and ?-synuclein.
25393609 2015 Pre-synaptic C-terminal truncated tau is released from cortical synapses in Alzheimer's disease.
25384392 2014 Tau deletion impairs intracellular ?-amyloid-42 clearance and leads to more extracellular plaque deposition in gene transfer models.
25378699 2014 SUMOylation at K340 inhibits tau degradation through deregulating its phosphorylation and ubiquitination.
25377499 2015 Frontotemporal dementia with parkinsonism linked to chromosome 17 with the MAPT?R406W mutation presenting with a broad distribution of abundant senile plaques.
25339173 2014 Oligomer formation of tau protein hyperphosphorylated in cells.
25331948 2014 The spleen tyrosine kinase (Syk) regulates Alzheimer amyloid-? production and Tau hyperphosphorylation.
25330988 2014 Frequent and symmetric deposition of misfolded tau oligomers within presynaptic and postsynaptic terminals in Alzheimer's disease.
25326800 2014 Cleavage of tau by asparagine endopeptidase mediates the neurofibrillary pathology in Alzheimer's disease.
25319522 2015 P301L tau expression affects glutamate release and clearance in the hippocampal trisynaptic pathway.
25306292 2014 Role of the extended MAPT haplotype in the worsening of psychotic symptoms and treatment response in Alzheimer disease.
25305495 2014 Association of microtubule associated protein tau/Saitohin (MAPT/STH) MAPT_238bp/STH Q7R polymorphisms and Parkinson's disease: A meta-analysis.
25284680 2014 Resonance Raman spectroscopic measurements delineate the structural changes that occur during tau fibril formation.
25241929 2014 PICALM modulates autophagy activity and tau accumulation.
25229151 2014 Tau binds to lipid membrane surfaces via short amphipathic helices located in its microtubule-binding repeats.
25178429 2014 APOE, MAPT, and SNCA genes and cognitive performance in Parkinson disease.
25151619 2014 Pathogenic tau species drive a psychosis-like phenotype in a mouse model of Alzheimer's disease.
25143394 2015 Mutant huntingtin alters Tau phosphorylation and subcellular distribution.
25131590 2014 The physiology and pathology of microtubule-associated protein tau.
25128526 2014 Cytoplasmic retention of protein phosphatase 2A inhibitor 2 (I2PP2A) induces Alzheimer-like abnormal hyperphosphorylation of Tau.
25112570 2014 Serum-induced neurite retraction in CAD cells--involvement of an ATP-actin retractile system and the lack of microtubule-associated proteins.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
25051234 2014 Intracellular clusterin interacts with brain isoforms of the bridging integrator 1 and with the microtubule-associated protein Tau in Alzheimer's disease.
25012224 2014 A data-driven model of biomarker changes in sporadic Alzheimer's disease.
25001178 2014 MicroRNA-125b induces tau hyperphosphorylation and cognitive deficits in Alzheimer's disease.
24977637 2014 The role of hippocampal tau protein phosphorylation in isoflurane-induced cognitive dysfunction in transgenic APP695 mice.
24965601 2015 Role of PrP(C) Expression in Tau Protein Levels and Phosphorylation in Alzheimer's Disease Evolution.
24929931 2014 Hirano bodies differentially modulate cell death induced by tau and the amyloid precursor protein intracellular domain.
24923570 Structural study of the microtubule-associated protein tau locus of Alzheimer's disease in Taiwan.
24915991 2014 Tau pathology does not affect experience-driven single-neuron and network-wide Arc/Arg3.1 responses.
24909306 2014 Loss of Tau results in defects in photoreceptor development and progressive neuronal degeneration in Drosophila.
24869773 2014 Lysine methylation is an endogenous post-translational modification of tau protein in human brain and a modulator of aggregation propensity.
24865638 2014 Memory deficits correlate with tau and spine pathology in P301S MAPT transgenic mice.
24861427 2014 No interaction between tau and TDP-43 pathologies in either frontotemporal lobar degeneration or motor neurone disease.
24857020 2014 Distinct tau prion strains propagate in cells and mice and define different tauopathies.
24853415 2014 Death-associated protein kinase 1 has a critical role in aberrant tau protein regulation and function.
24842889 2014 Genome-wide mapping of IBD segments in an Ashkenazi PD cohort identifies associated haplotypes.
24825901 2014 Stages and conformations of the Tau repeat domain during aggregation and its effect on neuronal toxicity.
24821615 2014 Tau protein mutation P364S in two sisters: clinical course and neuropathology with emphasis on new, composite neuronal tau inclusions.
24818585 2014 Associations between cerebral small-vessel disease and Alzheimer disease pathology as measured by cerebrospinal fluid biomarkers.
24808015 2014 Lower motor neuron disease with respiratory failure caused by a novel MAPT mutation.
24779391 2014 MAPT rs242562 and GSK3B rs334558 are associated with Parkinson's Disease in central China.
24741064 2015 Cerebral tau is elevated after aneurysmal subarachnoid haemorrhage and associated with brain metabolic distress and poor functional and cognitive long-term outcome.
24722794 2014 The relationships between the chemosensitivity of human gastric cancer to paclitaxel and the expressions of class III ?-tubulin, MAPT, and survivin.
24687422 2014 Transport and diffusion of Tau protein in neurons.
24675496 Topoisomerase II alpha and microtubule-associated protein-tau as a predictive marker in axillary lymph node positive breast cancer.
24656848 2014 Genetic modification of the relationship between phosphorylated tau and neurodegeneration.
24646911 2014 Tau protein modifications and interactions: their role in function and dysfunction.
24623856 2014 Immunophilin FKBP52 induces Tau-P301L filamentous assembly in vitro and modulates its activity in a model of tauopathy.
24581495 2014 Hsp90-Tau complex reveals molecular basis for specificity in chaperone action.
24566866 2014 Diagnostic performance of cerebrospinal fluid total tau and phosphorylated tau in Creutzfeldt-Jakob disease: results from the Swedish Mortality Registry.
24561013 2014 Evidence for autophagic gridlock in aging and neurodegeneration.
24559644 2014 MAPT IVS1+124 C>G modifies risk of LRRK2 G2385R for Parkinson's disease in Chinese individuals.
24559475 2014 OGlcNAcylation and phosphorylation have opposing structural effects in tau: phosphothreonine induces particular conformational order.
24519386 2014 Assessment of microtubule-associated protein (MAP)-Tau expression as a predictive and prognostic marker in TACT; a trial assessing substitution of sequential docetaxel for FEC as adjuvant chemotherapy for early breast cancer.
24511991 2014 Identification of a novel Parkinson's disease locus via stratified genome-wide association study.
24502945 2014 A functional fragment of Tau forms fibers without the need for an intermolecular cysteine bridge.
24498342 2014 Early structural and functional defects in synapses and myelinated axons in stratum lacunosum moleculare in two preclinical models for tauopathy.
24493463 2014 Amyloid-? and tau: the trigger and bullet in Alzheimer disease pathogenesis.
24492862 2014 Phosphorylated tau as a candidate biomarker for amyotrophic lateral sclerosis.
24464041 2014 Tau promotes neurodegeneration through global chromatin relaxation.
24448233 2014 The influence of the ?K280 mutation and N- or C-terminal extensions on the structure, dynamics, and fibril morphology of the tau R2 repeat.
24444746 2014 O-GlcNAc modification of tau directly inhibits its aggregation without perturbing the conformational properties of tau monomers.
24440055 2014 Synergistic effects of amyloid-beta and wild-type human tau on dendritic spine loss in a floxed double transgenic model of Alzheimer's disease.
24430504 2014 Interactions between Tau and ?-synuclein augment neurotoxicity in a Drosophila model of Parkinson's disease.
24429156 2013 Genetic variants associated with idiopathic pulmonary fibrosis susceptibility and mortality: a genome-wide association study.
24406748 2014 Early-onset cognitive deficits and axonal transport dysfunction in P301S mutant tau transgenic mice.
24401901 2014 Cerebrospinal fluid biomarkers in clinical subtypes of early-onset Alzheimer's disease.
24389273 2014 Annonacin, a natural lipophilic mitochondrial complex I inhibitor, increases phosphorylation of tau in the brain of FTDP-17 transgenic mice.
24389033 2014 Tau mRNA is present in axonal RNA granules and is associated with elongation factor 1A.
24387985 2014 Clinical and genetic analysis of MAPT, GRN, and C9orf72 genes in Korean patients with frontotemporal dementia.
24375821 2014 DNA methylation of the MAPT gene in Parkinson's disease cohorts and modulation by vitamin E in vitro.
24372973 2014 The microtubule associated protein tau H1 haplotype and risk of essential tremor.
24364857 2014 The role of anionic peptide fragments in 1N4R human tau protein aggregation.
24337498 2014 Neuropathological characterization of two siblings carrying the MAPT S305S mutation demonstrates features resembling argyrophilic grain disease.
24278327 2013 Tau causes synapse loss without disrupting calcium homeostasis in the rTg4510 model of tauopathy.
24278307 2013 Modeling Alzheimer's disease in mouse without mutant protein overexpression: cooperative and independent effects of A? and tau.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270207 2014 Hyperphosphorylated tau is elevated in Alzheimer's disease with psychosis.
24268747 2014 Serum tau protein level serves as a predictive factor for neurological prognosis in neonatal asphyxia.
24268156 2013 Interplay between velocity and travel distance of kinesin-based transport in the presence of tau.
24256615 2013 Difference in fibril core stability between two tau four-repeat domain proteins: a hydrogen-deuterium exchange coupled to mass spectrometry study.
24253235 2014 Clinical subtypes in Parkinson's disease: the impact of MAPT haplotypes.
24251416 2013 Phosphorylation of human Tau protein by microtubule affinity-regulating kinase 2.
24235150 2014 Extracellular monomeric tau protein is sufficient to initiate the spread of tau protein pathology.
24225352 2013 Pulse pressure is associated with Alzheimer biomarkers in cognitively normal older adults.
24218087 2014 Mutations in MAPT give rise to aneuploidy in animal models of tauopathy.
24212387 2013 CSF biomarkers of Alzheimer disease: "noncognitive" outcomes.
24165324 2014 Leucine-rich repeat kinase 2 regulates tau phosphorylation through direct activation of glycogen synthase kinase-3?.
24163366 2013 Antibody uptake into neurons occurs primarily via clathrin-dependent Fc? receptor endocytosis and is a prerequisite for acute tau protein clearance.
24150109 2014 Tau proteins harboring neurodegeneration-linked mutations impair kinesin translocation in vitro.
24146816 2013 Expression of Tau40 induces activation of cultured rat microglial cells.
24121548 2014 Novel mutation in MAPT exon 13 (p.N410H) causes corticobasal degeneration.
24116116 2013 Characterization of novel CSF Tau and ptau biomarkers for Alzheimer's disease.
24113872 2013 LRRK2 phosphorylates novel tau epitopes and promotes tauopathy.
24101602 2014 Altered CpG methylation in sporadic Alzheimer's disease is associated with APP and MAPT dysregulation.
24098548 2013 Protein disulfide isomerase interacts with tau protein and inhibits its fibrillization.
24089520 2013 Two novel Tau antibodies targeting the 396/404 region are primarily taken up by neurons and reduce Tau protein pathology.
24086739 2013 A novel MAPT mutation, G55R, in a frontotemporal dementia patient leads to altered Tau function.
24085246 2013 Cerebrospinal fluid biomarkers of Alzheimer's disease in Chinese patients: a pilot study.
24081456 2013 Development and validation of pedigree classification criteria for frontotemporal lobar degeneration.
24076336 2014 A role for tau at the synapse in Alzheimer's disease pathogenesis.
24076100 2014 Increased misfolding and truncation of tau in APP/PS1/tau transgenic mice compared to mutant tau mice.
24072703 2013 Structural determinants of Tau aggregation inhibitor potency.
24069608 2013 Microtubule-associated proteins in mesial temporal lobe epilepsy with and without psychiatric comorbidities and their relation with granular cell layer dispersion.
24063855 2013 RNA silencing of genes involved in Alzheimer's disease enhances mitochondrial function and synaptic activity.
24050961 2014 Intercellular transfer of tau aggregates and spreading of tau pathology: Implications for therapeutic strategies.
24041972 2014 Microtubule-associated protein tau genetic variations are uncommon cause of frontotemporal dementia in south India.
24037441 2014 Cyclic AMP-dependent protein kinase enhances SC35-promoted Tau exon 10 inclusion.
24028865 2014 Impact of the cellular prion protein on amyloid-? and 3PO-tau processing.
24018212 2014 Different mutations at V363 MAPT codon are associated with atypical clinical phenotypes and show unusual structural and functional features.
23999428 2013 Accelerated neurodegeneration through chaperone-mediated oligomerization of tau.
23962722 2014 Acetylation of the KXGS motifs in tau is a critical determinant in modulation of tau aggregation and clearance.
23959642 2012 Using the neanderthal and denisova genetic data to understand the common MAPT 17q21 inversion in modern humans.
23951348 2013 Interactions between A? and mutated Tau lead to polymorphism and induce aggregation of A?-mutated tau oligomeric complexes.
23951236 2013 GSK3B and MAPT polymorphisms are associated with grey matter and intracranial volume in healthy individuals.
23948940 2013 Of rodents and men: the mysterious interneuronal pilgrimage of misfolded protein tau in Alzheimer’s disease.
23948919 2013 Juvenile frontotemporal dementia with parkinsonism associated with tau mutation G389R.
23948915 2013 Phosphorylation of tau by death-associated protein kinase 1 antagonizes the kinase-induced cell apoptosis.
23948912 2013 Progressive age-related cognitive decline in tau mice.
23948904 2013 Dual-specificity tyrosine phosphorylation-regulated kinase 1A (Dyrk1A) enhances tau expression.
23948901 2013 Expression of Alzheimer-like pathological human tau induces a behavioral motor and olfactory learning deficit in Drosophila melanogaster.
23948900 2013 Global axonal transport rates are unaltered in htau mice in vivo.
23948895 2013 Tauopathies and tau oligomers.
23943618 2013 Leucine carboxyl methyltransferase 1 (LCMT1)-dependent methylation regulates the association of protein phosphatase 2A and Tau protein with plasma membrane microdomains in neuroblastoma cells.
23911736 2013 MAPT gene rs1052553 variant is not associated with the risk for multiple sclerosis.
23900411 2013 Parkinson's disease dementia: convergence of ?-synuclein, tau and amyloid-? pathologies.
23827424 2013 Cerebrospinal fluid brain injury biomarkers in children: a multicenter study.
23824268 2013 Amyloid-? may be released from non-junctional varicosities of axons generated from abnormal tau-containing brainstem nuclei in sporadic Alzheimer's disease: a hypothesis.
23798682 2013 An unbiased approach to identifying tau kinases that phosphorylate tau at sites associated with Alzheimer disease.
23798570 2013 Endogenous progesterone levels and frontotemporal dementia: modulation of TDP-43 and Tau levels in vitro and treatment of the A315T TARDBP mouse model.
23794287 2014 Presenilin-1 regulates the expression of p62 to govern p62-dependent tau degradation.
23789343 [Intensive protein synthesis in neurons and phosphorylation of beta-amyloid precursor protein and tau-protein are triggering factors of neuronal amyloidosis and Alzheimer's disease].
23727081 2014 Variants in PPP3R1 and MAPT are associated with more rapid functional decline in Alzheimer's disease: the Cache County Dementia Progression Study.
23721814 2013 Transgenic expression of the FTDP-17 tauV337M mutation in brain dissociates components of executive function in mice.
23717682 2013 An enzyme-generated fragment of tau measured in serum shows an inverse correlation to cognitive function.
23715095 2013 The influence of phospho-? on dendritic spines of cortical pyramidal neurons in patients with Alzheimer's disease.
23684085 2013 Tau pathology and neurodegeneration.
23681778 2013 Tau proteins expressions in advanced breast cancer and its significance in taxane-containing neoadjuvant chemotherapy.
23666762 2013 Role of individual MARK isoforms in phosphorylation of tau at Ser²?² in Alzheimer's disease.
23666174 2013 Cerebrospinal fluid A?1-40 improves differential dementia diagnosis in patients with intermediate P-tau181P levels.
23664753 2013 TDP-43 pathology in a patient carrying G2019S LRRK2 mutation and a novel p.Q124E MAPT.
23659998 2013 Molecular mechanisms of Tau binding to microtubules and its role in microtubule dynamics in live cells.
23640887 2013 Activation of asparaginyl endopeptidase leads to Tau hyperphosphorylation in Alzheimer disease.
23631819 2013 Tau protein as a potential predictive marker in epithelial ovarian cancer patients treated with paclitaxel/platinum first-line chemotherapy.
23624859 2013 The microtubule-associated tau protein has intrinsic acetyltransferase activity.
23621301 2013 Alzheimer's disease risk, obesity and tau: is insulin resistance guilty?
23597931 2014 Comparison between clinical diagnosis and CSF biomarkers of Alzheimer disease in elderly patients with late onset psychosis: Helsinki Old Age Psychosis Study (HOPS).
23589030 2013 Clathrin adaptor CALM/PICALM is associated with neurofibrillary tangles and is cleaved in Alzheimer's brains.
23585566 2013 Mammalian target of rapamycin (mTor) mediates tau protein dyshomeostasis: implication for Alzheimer disease.
23585562 2013 Prostate-derived sterile 20-like kinases (PSKs/TAOKs) phosphorylate tau protein and are activated in tangle-bearing neurons in Alzheimer disease.
23583980 2013 Genome-wide association study identifies multiple susceptibility loci for pulmonary fibrosis.
23576620 2013 Amyloid imaging and CSF biomarkers in predicting cognitive impairment up to 7.5 years later.
23566348 2013 BACE1 levels correlate with phospho-tau levels in human cerebrospinal fluid.
23562579 2013 Prolyl oligopeptidase colocalizes with ?-synuclein, ?-amyloid, tau protein and astroglia in the post-mortem brain samples with Parkinson's and Alzheimer's diseases.
23554879 2013 PINCH in the cellular stress response to tau-hyperphosphorylation.
23528367 2013 The intersection of amyloid ? and tau in glutamatergic synaptic dysfunction and collapse in Alzheimer's disease.
23518664 Neurodegenerative disease phenotypes in carriers of MAPT p.A152T, a risk factor for frontotemporal dementia spectrum disorders and Alzheimer disease.
23515417 2013 Initiation of assembly of tau(273-284) and its ?K280 mutant: an experimental and computational study.
23507417 2013 Genetic susceptibility loci, environmental exposures, and Parkinson's disease: a case-control study of gene-environment interactions.
23499461 2013 Embryonic stem cell-based modeling of tau pathology in human neurons.
23487739 2013 HDAC6 mutations rescue human tau-induced microtubule defects in Drosophila.
23479202 2013 Correlation of specific amyloid-? oligomers with tau in cerebrospinal fluid from cognitively normal older adults.
23475817 2013 White matter imaging helps dissociate tau from TDP-43 in frontotemporal lobar degeneration.
23475578 2013 Predictive and prognostic values of Tau and BubR1 protein in prostate cancer and their relationship to the Gleason score.
23458258 2013 A flash in the pan: dissecting dynamic amyloid intermediates using fluorescence.
23446558 2013 Relationship between gastric cancer tau protein expression and paclitaxel sensitivity.
23443659 2013 Aminothienopyridazines and methylene blue affect Tau fibrillization via cysteine oxidation.
23423488 2013 Regulation of microtubule-associated protein tau (MAPT) by miR-34c-5p determines the chemosensitivity of gastric cancer to paclitaxel.
23418567 2013 Increased tau phosphorylation and tau truncation, and decreased synaptophysin levels in mutant BRI2/tau transgenic mice.
23399914 2013 Increased expression of BIN1 mediates Alzheimer genetic risk by modulating tau pathology.
23396350 2013 Application of yeast to study the tau and amyloid-? abnormalities of Alzheimer's disease.
23362255 2013 Isomerase Pin1 stimulates dephosphorylation of tau protein at cyclin-dependent kinase (Cdk5)-dependent Alzheimer phosphorylation sites.
23358800 2014 Relationship of 14-3-3zeta (?), HIF-1?, and VEGF expression in human brain gliomas.
23340677 2013 Glutamate metabolism is impaired in transgenic mice with tau hyperphosphorylation.
23338682 2013 Distinct clinical characteristics of C9orf72 expansion carriers compared with GRN, MAPT, and nonmutation carriers in a Flanders-Belgian FTLD cohort.
23332172 2013 5-Lipoxygenase pharmacological blockade decreases tau phosphorylation in vivo: involvement of the cyclin-dependent kinase-5.
23332171 2013 Age-appropriate cognition and subtle dopamine-independent motor deficits in aged tau knockout mice.
23317568 2013 Genetic study on frontotemporal lobar degeneration in India.
23276384 2013 A ketone ester diet exhibits anxiolytic and cognition-sparing properties, and lessens amyloid and tau pathologies in a mouse model of Alzheimer's disease.
23269837 2013 The fuzzy coat of pathological human Tau fibrils is a two-layered polyelectrolyte brush.
23264626 2013 Curcumin suppresses soluble tau dimers and corrects molecular chaperone, synaptic, and behavioral deficits in aged human tau transgenic mice.
23254634 2013 Hyperglycemia-induced tau cleavage in vitro and in vivo: a possible link between diabetes and Alzheimer's disease.
23247080 2013 Observations in THY-Tau22 mice that resemble behavioral and psychological signs and symptoms of dementia.
23237806 2013 Involvement of endoplasmic reticulum stress in tauopathy.
23234879 2013 Early clinical PET imaging results with the novel PHF-tau radioligand [F-18]-T807.
23225000 2012 Tau fibrillogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160422 2012 Where, when, and in what form does sporadic Alzheimer's disease begin?
23157676 2013 Distinct functions of cis and trans phosphorylated tau in Alzheimer's disease and their therapeutic implications.
23154429 2012 Intellectual functioning of childhood leukemia survivors--relation to Tau protein--a marker of white matter injury.
23129775 2012 Tau oligomers impair artificial membrane integrity and cellular viability.
23121543 2014 Agraphia in patients with frontotemporal dementia and parkinsonism linked to chromosome 17 with P301L MAPT mutation: dysexecutive, aphasic, apraxic or spatial phenomenon?
23114515 2013 Low endogenous and chemical induced heat shock protein induction in a 0N3Rtau-expressing Drosophila larval model of Alzheimer's disease.
23105105 2012 Extracellular Tau levels are influenced by variability in Tau that is associated with tauopathies.
23087208 2012 Taxol-stabilized microtubules promote the formation of filaments from unmodified full-length Tau in vitro.
23085090 2012 Non-taxoid site microtubule-stabilizing drugs work independently of tau overexpression in mouse N2a neuroblastoma cells.
23064258 2013 Selective brain gray matter atrophy associated with APOE ?4 and MAPT H1 in subjects with mild cognitive impairment.
23053136 2013 Mixed tau, TDP-43 and p62 pathology in FTLD associated with a C9ORF72 repeat expansion and p.Ala239Thr MAPT (tau) variant.
23047372 2013 Mutations in MAPT gene cause chromosome instability and introduce copy number variations widely in the genome.
23043292 2012 FTDP-17 tau mutations induce distinct effects on aggregation and microtubule interactions.
23041958 2012 Origins of Alzheimer's disease: reconci