Property Summary

NCBI Gene PubMed Count 1,248
Grant Count 1,177
R01 Count 497
Funding $192,721,529.19
PubMed Score 6601.97
PubTator Score 1699.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (60)

Disease Z-score Confidence
Alzheimer's disease 644 7.46 3.7
Dementia 129 6.53 3.3
Brain disease 83 6.518 3.3
Pick's disease 14 6.397 3.2
Parkinson's disease 364 5.118 2.6
Aphasia 22 4.793 2.4
Toxic encephalopathy 131 4.164 2.1
Amyotrophic Lateral Sclerosis 431 4.159 2.1
Pelvic inflammatory disease 21 4.157 2.1
Apraxia 25 4.031 2.0
Multiple system atrophy 27 3.856 1.9
Cerebrovascular disease 231 3.779 1.9
Koolen de Vries syndrome 15 3.369 1.7
Cancer 2,346 3.201 1.6
Down syndrome 548 3.2 1.6
Heart disease 279 3.013 1.5
Duodenal Ulcer due to H. Pylori 7
Duodenal ulcer disease 7
Erosive esophagitis 6
Frontotemporal dementia 41
Gastric Hypersecretory Conditions 5
Gastric ulcer 34
Gastroesophageal reflux disease 37
Learning Disorders 27
Lung Diseases, Interstitial 15
Maintenance of Healing Duodenal Ulcer 7
Memory Disorders 36
NSAID-Induced Gastric Ulcer 4
Neurodegenerative Disorders 37
Neurodegenerative disease 383 4.0
Osteoporosis 257 2.0
PARKINSON DISEASE, LATE-ONSET 18
Parkinson Disease 102
Parkinsonian Disorders 23
Peptic ulcer 22
Pick Disease of the Brain 2
Pick disease 1,893
Primary Progressive Nonfluent Aphasia 6
Respiratory Insufficiency 11
Semantic Dementia 6
Supranuclear Palsy, Progressive, 1, Atyp... 1 
Tauopathies 1
Zollinger-Ellison Syndrome 14
adult high grade glioma 2,148
atypical teratoid / rhabdoid tumor 4,369
cutaneous lupus erythematosus 1,056
ependymoma 2,514
glioblastoma 5,572
inflammatory breast cancer 404
interstitial lung disease 291 2.0
lung carcinoma 2,844
medulloblastoma 1,524
medulloblastoma, large-cell 6,234
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pilocytic astrocytoma 3,086
progressive supranuclear palsy 674 5.0
psoriasis 6,685
subependymal giant cell astrocytoma 2,287

Expression

  Differential Expression (16)

Disease log2 FC p
oligodendroglioma 1.400 0.019
psoriasis -1.600 0.000
cutaneous lupus erythematosus -1.500 0.012
glioblastoma -2.300 0.006
osteosarcoma 1.752 0.000
ependymoma -1.900 0.000
medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -2.700 0.000
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.600 0.000
subependymal giant cell astrocytoma -2.066 0.006
inflammatory breast cancer -2.500 0.027
lung carcinoma 2.900 0.000
Pick disease -1.100 0.000
ovarian cancer -1.400 0.000

Synonym

Accession P10636 P18518 Q14799 Q15549 Q15550 Q15551 Q1RMF6 Q53YB1 Q5CZI7 Q5XWF0 Q6QT54 Q9UDJ3 Q9UMH0 Q9UQ96
Symbols TAU
MSTD
PPND
DDPAC
MAPTL
MTBT1
MTBT2
FTDP-17
PPP1R103

Gene

PDB

4FL5   4Y32   4Y3B   4Y5I   5HF3   1I8H   2MZ7   2ON9   3OVL   4E0M   4E0N   4E0O   4GLR   4NP8   4TQE   5DMG   5E2V   5E2W  

Gene RIF (1148)

PMID Text
27129267 tau inclusions are dynamic structures constantly undergoing "fission" and "fusion," which facilitate stable propagation of tau pathology in dividing cells.
27118310 that the mutant Tau(A152T) induces neuronal dysfunction, morphological alterations in neurons akin to aging phenotype and reduced life-span independently of aggregation
27100392 Mutations in tau gene is the genetic causes of frontotemporal lobar degeneration.
27030011 This study demonstrates that extracellular vesicles can transmit tau pathology.
27023670 These results suggest that stabilization of microtubule-unbound tau by phosphorylation at Ser262/356 via the PAR-1/MARK may act in the initial steps of tau mismetabolism in AD pathogenesis
26916334 The hTau40(AT) mice mimic pathological hallmarks of tauopathies including a cognitive phenotype combined with pronounced neuroinflammation visible by bioluminescence.
26903089 The capacity FKBP52 to oligomerize Tau is not linked to its peptidyl-prolyl isomerase activity.
26876913 CSF concentrations of T-tau and P-tau in bipolar disorder-mild cognitive impairment patients were similar to those in controls, and significantly lower than those in Alzheimer disease.
26852117 Multiple signaling factors and drugs alleviate neuronal death induced by expression of human and zebrafish tau proteins in vivo.
26824039 MAPT may play an important role in insulin granule trafficking and indicate the importance of balanced MAPT phosphorylation and dephosphorylation for adequate insulin release.
More...

AA Sequence

MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTP      1 - 70
TAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREP     71 - 140
GPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEGPPLKGAGGKE    141 - 210
RPGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIP    211 - 280
ASEPDGPSVGRAKGQDAPLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEAD    281 - 350
LPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS    351 - 420
DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQKGQANATRIPA    421 - 490
KTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRL    491 - 560
QTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPV    561 - 630
DLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAK    631 - 700
AKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL                701 - 758
//

Text Mined References (1266)

PMID Year Title
27306859 2016 Tau physiology and pathomechanisms in frontotemporal lobar degeneration.
27129267 2016 The Dynamics and Turnover of Tau Aggregates in Cultured Cells: INSIGHTS INTO THERAPIES FOR TAUOPATHIES.
27118310 2016 Tau mutant A152T, a risk factor for FTD/PSP, induces neuronal dysfunction and reduced lifespan independently of aggregation in a C. elegans Tauopathy model.
27100392 2016 Characterization of Movement Disorder Phenomenology in Genetically Proven, Familial Frontotemporal Lobar Degeneration: A Systematic Review and Meta-Analysis.
27030011 2016 Extracellular Vesicles Isolated from the Brains of rTg4510 Mice Seed Tau Protein Aggregation in a Threshold-dependent Manner.
27023670 2016 Stabilization of Microtubule-Unbound Tau via Tau Phosphorylation at Ser262/356 by Par-1/MARK Contributes to Augmentation of AD-Related Phosphorylation and A?42-Induced Tau Toxicity.
26916334 2016 Age-dependent neuroinflammation and cognitive decline in a novel Ala152Thr-Tau transgenic mouse model of PSP and AD.
26903089 2016 Isomerization and Oligomerization of Truncated and Mutated Tau Forms by FKBP52 are Independent Processes.
26876913 2016 Cognitive impairment in late-life bipolar disorder is not associated with Alzheimer's disease pathological signature in the cerebrospinal fluid.
26852117 2016 Multiple signaling factors and drugs alleviate neuronal death induced by expression of human and zebrafish tau proteins in vivo.
More...