Property Summary

NCBI Gene PubMed Count 30
PubMed Score 132.53
PubTator Score 59.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis -3.700 6.4e-06
astrocytoma -1.400 6.6e-19
glioblastoma -1.500 2.1e-05
oligodendroglioma -1.400 4.0e-18
atypical teratoid / rhabdoid tumor -1.600 2.1e-05
sonic hedgehog group medulloblastoma -1.700 4.5e-03
medulloblastoma, large-cell -1.700 2.6e-04
active Crohn's disease -1.075 3.0e-02
adult high grade glioma -1.900 2.4e-03
pilocytic astrocytoma -1.100 7.1e-03
subependymal giant cell astrocytoma -1.863 2.8e-02
lung carcinoma 2.200 1.5e-24
Pick disease -1.700 4.7e-04
ovarian cancer -1.400 2.8e-05
dermatomyositis -1.400 2.1e-03

Gene RIF (13)

PMID Text
24478452 Aptamers binding to human EB1 and EB3, which have sequence requirements similar to but distinct from each other and from Drosophila EB1, were identified.
24040250 EB1 and EB3 proteins are obligatory dimers.
23712260 Daughter cell adhesion and cytokinesis completion are spatially regulated by distinct states of EB3 phosphorylation on serine 176 by Aurora B.
23456299 Findings suggest that methylation-associated down-regulation of EBF3 and IRX1 genes may play an important role in a pathogenic effect of TGF-beta on RASFs.
23159740 VE-cadherin outside-in signaling regulates cytosolic calcium homeostasis and EB3 phosphorylation.
22275434 decreasing the drebrin E levels disrupted the normal subapical F-actin-myosin-IIB-betaII-spectrin network and the apical accumulation of EB3, a microtubule-plus-end-binding protein
21768326 Data indicated that EB1 and EB3 interact with proteins implicated in MT minus-end anchoring or vesicular trafficking to the cilia base, suggesting that EB1 and EB3 promote ciliogenesis by facilitating such trafficking.
20632835 study found a polycytosine repeat (C8) in exon 5 of MAPRE3 that could be a potential mutation target in cancers with microsatellite instability (MSI); found that the C8 is frequently mutated in gastric and colorectal carcinomas with MSI
20008324 heterodimer formation between EB1 and EB3, but not between EB2 and the other two EBs, occurs both in vitro and in cells as revealed by live cell imaging
19696028 Data show that two mitotic kinases, Aurora-A and Aurora-B, phosphorylate endogenous EB3 at Ser-176, and the phosphorylation triggers disruption of the EB3-SIAH-1 complex, resulting in EB3 stabilization during mitosis.
19255245 Protein depletion and rescue experiments showed that EB1 and EB3, but not EB2, promote persistent microtubule growth by suppressing catastrophes.
16079286 The RP3 protein is involved in SATB1-mediated gene repression of Bcl2 and dynein subunit rp3 has functions independent of the dynein motor.
14514668 neither APC nor p150glued binding domain is necessary for EB1 or EBF3 to induce microtubule bundling

AA Sequence

MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHE      1 - 70
YIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPN     71 - 140
PGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLV    141 - 210
DLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDE    211 - 280
Y//

Text Mined References (36)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
24478452 2014 Peptide aptamers define distinct EB1- and EB3-binding motifs and interfere with microtubule dynamics.
24040250 2013 End binding proteins are obligatory dimers.
23712260 2013 Aurora B spatially regulates EB3 phosphorylation to coordinate daughter cell adhesion with cytokinesis.
23456299 2013 Hypermethylation of EBF3 and IRX1 genes in synovial fibroblasts of patients with rheumatoid arthritis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23159740 2012 VE-cadherin signaling induces EB3 phosphorylation to suppress microtubule growth and assemble adherens junctions.
22275434 2012 Apico-basal elongation requires a drebrin-E-EB3 complex in columnar human epithelial cells.
21768326 2011 EB1 and EB3 promote cilia biogenesis by several centrosome-related mechanisms.
21646404 2011 SLAIN2 links microtubule plus end-tracking proteins and controls microtubule growth in interphase.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20632835 2010 Frameshift mutation of MAPRE3, a microtubule-related gene, in gastric and colorectal cancers with microsatellite instability.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20008324 2010 Molecular insights into mammalian end-binding protein heterodimerization.
19696028 2009 Mitotic regulation of the stability of microtubule plus-end tracking protein EB3 by ubiquitin ligase SIAH-1 and Aurora mitotic kinases.
19255245 2009 Mammalian end binding proteins control persistent microtubule growth.
19146815 2009 Dynamic microtubules regulate dendritic spine morphology and synaptic plasticity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17563362 2007 Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition.
17310996 2007 p53 downstream target DDA3 is a novel microtubule-associated protein that interacts with end-binding protein EB3 and activates beta-catenin pathway.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16079286 2005 Dynein light chain rp3 acts as a nuclear matrix-associated transcriptional modulator in a dynein-independent pathway.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15631994 2005 CLASP1 and CLASP2 bind to EB1 and regulate microtubule plus-end dynamics at the cell cortex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14514668 2003 Characterization of functional domains of human EB1 family proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11161807 2001 Characterization of human MAPRE genes and their proteins.
10644998 2000 EB3, a novel member of the EB1 family preferentially expressed in the central nervous system, binds to a CNS-specific APC homologue.
10188731 1999 EB/RP gene family encodes tubulin binding proteins.
9233623 1997 RP1, a new member of the adenomatous polyposis coli-binding EB1-like gene family, is differentially expressed in activated T cells.