Property Summary

NCBI Gene PubMed Count 37
PubMed Score 77.34
PubTator Score 45.30

Knowledge Summary

Patent (9,373)

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4473 1.2e-02
Disease Target Count Z-score Confidence
Vitamin K deficiency hemorrhagic disease 11 3.287 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.600 1.2e-02

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (14)

PMID Text
26758977 PRAK might be a potential therapeutic target of Alzheimer's disease involved in receptor for advanced glycation end products-mediated cell signaling induced by Abeta
26080319 Plasma MAPKAPK5 protein was found to positively associate with the 10-year change in paired associates learning assessment in asymptomatic older twins.
25383140 Data highlight that DJ-1 is the downstream interacting target for PRAK, and in response to oxidative stress PRAK may exert a cytoprotective effect by facilitating DJ-1 to sequester Daxx in the nucleus, thus preventing cell death.
24651460 Data indicate that the structurally most flexible regions during molecular dynamics (MD) simulations of the native mitogen-activated protein kinase-activated protein kinase MK5 model were the loop regions.
24309468 Studies with specific phosphoantibodies indicate that MK5 phosphorylates Hsp40/DnaJB1 in vivo at Ser-149 or/and Ser-151 and Ser-171 in the C-terminal domain of Hsp40/DnaJB1.
23685072 study shows Tip60 plays an essential role in oncogenic ras-induced senescence; revealed a cascade of posttranslational modifications involving p38, Tip60 and PRAK, 3 proteins essential for ras-induced senescence; these modifications are critical for prosenescent function of Tip60 and PRAK
23022185 these results firstly demonstrate that MK5 is degraded in response to doxorubicin and negatively regulates doxorubicin-induced apoptosis, providing novel insights into the molecular mechanism of doxorubicin resistance in hepatoma cells.
22279049 IGF2BP1 promotes the velocity and directionality of tumor-derived cell migration by determining the cytoplasmic fate of two novel target mRNAs: MAPK4 and PTEN
21336308 Rheb inactivation by PRAK-mediated phosphorylation is essential for energy-depletion-induced suppression of mTORC1
21177870 Activation loop phosphorylation of ERK3/ERK4 by group I p21-activated kinases (PAKs) defines a novel PAK-ERK3/4-MAPK-activated protein kinase 5 signaling pathway.
20849292 This review discusses the different characteristics of regulating the activity and subcellular localization of MK5 and RSK1 by PKA and the functional implications of these interactions.
19484198 Several binding motifs for heat shock factor are dispersed in the mouse and rat promoter, and temperature shock transiently enhanced the MAP-kinase-activated kinase 5 transcript levels.
19473979 Data defined a novel MK5 interaction motif (FRIEDE) within both ERK4 and ERK3 that is essential for binding to the C-terminal region of MK5.
19166925 results imply that MK5 is involved in Hsp27-controlled F-actin dynamics in response to activation of the cAMP-dependent protein kinase pathway.

AA Sequence

MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCA      1 - 70
THPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCH     71 - 140
LLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIP    141 - 210
TSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDV    211 - 280
VRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLK    281 - 350
PLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQ    351 - 420
EAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ                     421 - 473
//

Text Mined References (45)

PMID Year Title
26972000 2016 Substrate-Trapped Interactors of PHD3 and FIH Cluster in Distinct Signaling Pathways.
26758977 2016 The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis.
26080319 2015 Plasma protein biomarkers of Alzheimer's disease endophenotypes in asymptomatic older twins: early cognitive decline and regional brain volumes.
25416956 2014 A proteome-scale map of the human interactome network.
25383140 2014 PRAK interacts with DJ-1 and prevents oxidative stress-induced cell death.
24651460 2014 Comparative molecular dynamics simulations of mitogen-activated protein kinase-activated protein kinase 5.
24309468 2014 Phosphorylation of heat shock protein 40 (Hsp40/DnaJB1) by mitogen-activated protein kinase-activated protein kinase 5 (MK5/PRAK).
23685072 2013 A posttranslational modification cascade involving p38, Tip60, and PRAK mediates oncogene-induced senescence.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23022185 2012 MK5 is degraded in response to doxorubicin and negatively regulates doxorubicin-induced apoptosis in hepatocellular carcinoma cells.
22279049 2012 IGF2BP1 promotes cell migration by regulating MK5 and PTEN signaling.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21575178 2011 Distinct roles of MK2 and MK5 in cAMP/PKA- and stress/p38MAPK-induced heat shock protein 27 phosphorylation.
21531765 2011 High-throughput RNAi screening reveals novel regulators of telomerase.
21336308 2011 Inactivation of Rheb by PRAK-mediated phosphorylation is essential for energy-depletion-induced suppression of mTORC1.
21329882 2011 The MK5/PRAK kinase and Myc form a negative feedback loop that is disrupted during colorectal tumorigenesis.
21177870 2011 Activation loop phosphorylation of ERK3/ERK4 by group I p21-activated kinases (PAKs) defines a novel PAK-ERK3/4-MAPK-activated protein kinase 5 signaling pathway.
20936779 2010 A human MAP kinase interactome.
20849292 2011 Cross-talk between protein kinase A and the MAPK-activated protein kinases RSK1 and MK5.
20227494 2010 Mitogen-activated protein kinase p38 and MK2, MK3 and MK5: ménage à trois or ménage à quatre?
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19484198 2009 The transcriptional regulation and cell-specific expression of the MAPK-activated protein kinase MK5.
19473979 2009 Docking of PRAK/MK5 to the atypical MAPKs ERK3 and ERK4 defines a novel MAPK interaction motif.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19166925 2009 PKA-induced F-actin rearrangement requires phosphorylation of Hsp27 by the MAPKAP kinase MK5.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17728103 2007 14-3-3epsilon inhibits MK5-mediated cell migration by disrupting F-actin polymerization.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17254968 2007 PRAK is essential for ras-induced senescence and tumor suppression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12808055 2003 Regulation of PRAK subcellular location by p38 MAP kinases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12171600 2002 Stress-induced regulation of eukaryotic elongation factor 2 kinase by SB 203580-sensitive and -insensitive pathways.
12130507 2002 Analysis of V(lambda)-J(lambda) expression in plasma cells from primary (AL) amyloidosis and normal bone marrow identifies 3r (lambdaIII) as a new amyloid-associated germline gene segment.
12117915 2002 Recurrent variable region gene usage and somatic mutation in the human antibody response to the capsular polysaccharide of Streptococcus pneumoniae type 23F.
10978317 2000 Serine 727 phosphorylation and activation of cytosolic phospholipase A2 by MNK1-related protein kinases.
10708586 2000 p62 functions as a p38 MAP kinase regulator.
9628874 1998 PRAK, a novel protein kinase regulated by the p38 MAP kinase.
9480836 1998 MAPKAPK5, a novel mitogen-activated protein kinase (MAPK)-activated protein kinase, is a substrate of the extracellular-regulated kinase (ERK) and p38 kinase.
9468497 1998 Identification of the phosphorylation sites of cytosolic phospholipase A2 in agonist-stimulated human platelets and HeLa cells.
8636128 1996 Identification of phosphorylation sites of human 85-kDa cytosolic phospholipase A2 expressed in insect cells and present in human monocytes.