Property Summary

NCBI Gene PubMed Count 36
PubMed Score 49.61
PubTator Score 44.44

Knowledge Summary

Patent (10,086)

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.000 4.4e-07
psoriasis 1.400 2.7e-08
osteosarcoma -1.900 5.0e-05
ependymoma 1.300 9.0e-07
glioblastoma 1.100 1.4e-03
tuberculosis 1.300 3.5e-06
colon cancer 1.200 5.5e-04

 MGI Phenotype (1)

Protein-protein Interaction (11)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (11)

PMID Text
25853770 MK3 modulation affects BMI1-dependent and independent cell cycle check-points
25693418 findings reveal MK2/MK3 as crucial stress-responsive kinases that promote autophagy through Beclin 1 S90 phosphorylation
23487458 Hepatitis C virus core protein interacted with MAPKAPK3 through amino acid residues 41 to 75 of core and the N-terminal half of kinase domain of MAPKAPK3.
23127979 Identified CREB activators MAPKAPK3 and FHL5 as mediators of intimal hyperplasia in vein graft samples.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19937655 A high-resolution (1.9 A) crystal structure of the highly homologous MK3 in complex with a pharmaceutical lead compound is presented.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19208361 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15302577 3pK is transported to the cytoplasm upon both stress and mitogenic stimulation. While kinetics of nuclear export are similar in both situations, the activation pattern differs substantially.
11975836 In the preconditioned heart, genes for MAPKAP kinase 3 were up-regulated.

AA Sequence

MDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPKKYAVTDDYQLSKQVLGLGVNGKVLECFHRRTGQKC      1 - 70
ALKLLYDSPKARQEVDHHWQASGGPHIVCILDVYENMHHGKRCLLIIMECMEGGELFSRIQERGDQAFTE     71 - 140
REAAEIMRDIGTAIQFLHSHNIAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYYVA    141 - 210
PEVLGPEKYDKSCDMWSLGVIMYILLCGFPPFYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDAKQL    211 - 280
IRLLLKTDPTERLTITQFMNHPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVK    281 - 350
IKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ                                          351 - 382
//

Text Mined References (46)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25853770 2015 MK3 modulation affects BMI1-dependent and independent cell cycle check-points.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25693418 2015 The stress-responsive kinases MAPKAPK2/MAPKAPK3 activate starvation-induced autophagy through Beclin 1 phosphorylation.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23487458 2013 Modulation of mitogen-activated protein kinase-activated protein kinase 3 by hepatitis C virus core protein.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23127979 2013 Cyclic adenosine monophosphate response-element binding protein activation by mitogen-activated protein kinase-activated protein kinase 3 and four-and-a-half LIM domains 5 plays a key role for vein graft intimal hyperplasia.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21575178 2011 Distinct roles of MK2 and MK5 in cAMP/PKA- and stress/p38MAPK-induced heat shock protein 27 phosphorylation.
21565500 2011 Structure-based lead identification of ATP-competitive MK2 inhibitors.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20599781 2010 MAPKAP kinases MK2 and MK3 in inflammation: complex regulation of TNF biosynthesis via expression and phosphorylation of tristetraprolin.
19937655 2010 High-resolution crystal structure of human Mapkap kinase 3 in complex with a high affinity ligand.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19208361 2009 A polymorphism in MAPKAPK3 affects response to interferon therapy for chronic hepatitis C.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18508601 2008 MK2 and MK3--a pair of isoenzymes?
18021073 2008 Roles for TAB1 in regulating the IL-1-dependent phosphorylation of the TAB3 regulatory subunit and activity of the TAK1 complex.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15850461 2005 The phosphorylation of CapZ-interacting protein (CapZIP) by stress-activated protein kinases triggers its dissociation from CapZ.
15563468 2005 MAPKAP kinase 3pK phosphorylates and regulates chromatin association of the polycomb group protein Bmi1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302577 2004 Mitogen-activated 3p kinase is active in the nucleus.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12171600 2002 Stress-induced regulation of eukaryotic elongation factor 2 kinase by SB 203580-sensitive and -insensitive pathways.
11520933 2001 Nerve growth factor signaling, neuroprotection, and neural repair.
11157753 2001 Identification of a docking groove on ERK and p38 MAP kinases that regulates the specificity of docking interactions.
10781029 2000 Serine/Threonine kinases 3pK and MAPK-activated protein kinase 2 interact with the basic helix-loop-helix transcription factor E47 and repress its transcriptional activity.
10383393 1999 Regulation of Hsp27 oligomerization, chaperone function, and protective activity against oxidative stress/tumor necrosis factor alpha by phosphorylation.
9297626 1997 Ras effectors and their role in mitogenesis and oncogenesis.
9207191 1997 Novel homologues of CSBP/p38 MAP kinase: activation, substrate specificity and sensitivity to inhibition by pyridinyl imidazoles.
8943323 1996 3pK, a novel mitogen-activated protein (MAP) kinase-activated protein kinase, is targeted by three MAP kinase pathways.
8846784 1995 Identification of novel phosphorylation sites required for activation of MAPKAP kinase-2.
8774846 1996 A comparison of the substrate specificity of MAPKAP kinase-2 and MAPKAP kinase-3 and their activation by cytokines and cellular stress.
8626550 1996 Identification of mitogen-activated protein (MAP) kinase-activated protein kinase-3, a novel substrate of CSBP p38 MAP kinase.
8622688 1996 3pK, a new mitogen-activated protein kinase-activated protein kinase located in the small cell lung cancer tumor suppressor gene region.
8603390 1996 Construction of a 600-kilobase cosmid clone contig and generation of a transcriptional map surrounding the lung cancer tumor suppressor gene (TSG) locus on human chromosome 3p21.3: progress toward the isolation of a lung cancer TSG.
7799959 1995 Modulation of cellular thermoresistance and actin filament stability accompanies phosphorylation-induced changes in the oligomeric structure of heat shock protein 27.