Property Summary

NCBI Gene PubMed Count 120
PubMed Score 140.71
PubTator Score 280.02

Knowledge Summary

Patent (10,886)

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.800 5.9e-05
breast carcinoma 1.100 9.6e-15
COPD -1.200 6.5e-03
dermatomyositis -1.200 4.6e-03
ependymoma 1.400 3.7e-04
glioblastoma 2.900 1.7e-06
invasive ductal carcinoma 1.100 2.4e-03
medulloblastoma 1.500 3.7e-03
medulloblastoma, large-cell 1.600 2.8e-03
osteosarcoma 1.498 6.3e-07
pediatric high grade glioma 2.000 8.4e-05
Pilocytic astrocytoma 1.100 2.0e-02
pituitary cancer -1.200 2.8e-03
primitive neuroectodermal tumor 1.200 3.1e-03
psoriasis -1.300 3.4e-04
ulcerative colitis 1.300 6.3e-04

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (64)

AA Sequence

MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVL      1 - 70
GLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMEC     71 - 140
LDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGF    141 - 210
AKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIR    211 - 280
MGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWE    281 - 350
DVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH                        351 - 400
//

Text Mined References (136)

PMID Year Title