Property Summary

NCBI Gene PubMed Count 36
PubMed Score 98.89
PubTator Score 570.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (26)

PMID Text
26235620 Akt phosphorylates SIN1 at T86, enhancing mTORC2 kinase activity, which leads to phosphorylation of Akt S473 by mTORC2, thereby catalyzing full activation of Akt.
25153992 MAPKAP1 may represent a novel anti-infection and anti-fibrogenesis genomic locus in chronic schistosomiasis japonica.
24926550 mitogen-activated protein kinase associated protein 1 rs10118570 may be an important protective factor for developing better management strategies in lung squamous cell carcinoma.
24395886 Estradiol and mTORC2 cooperate to enhance prostaglandin biosynthesis and tumorigenesis in TSC2-deficient lymphangioleiomyomatosis cells.
24365180 DNA-PKcs-mTORC2(SIN1) association is required for UVB-induced Akt Ser-473 phosphorylation and cell survival.
24161930 results reveal a Sin1-phosphorylation-dependent mTORC2 regulation, providing a potential molecular mechanism by which mutations in the mTORC1-S6K-Sin1 signalling axis might cause aberrant hyper-activation of the mTORC2-Akt pathway
23762398 NBS1 interacts with the mTOR/Rictor/SIN1 complex through the a.a. 221-402 domain and contributes to the activation of Akt activity.
23564492 SIN1 plays an important role in hepatocellular carcinoma invasion and metastasis by facilitating epithelial-mesenchymal transition.
22505404 structures show that the C-termini of Avo1 and Sin1 both have the pleckstrin homology (PH) domain fold
21757730 mSIN1 protein mediates SGK1 protein interaction with mTORC2 protein complex and is required for selective activation of the epithelial sodium channel
21170086 There is an increased mitochondrial dependence upon mTORC2 dependent cell growth due to PTEN loss
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
18687895 SIN1 and PCBP2 are generally coregulated with large numbers of genes implicated in both cell survival and death and in cellular stress responses, including RNA translation and processing
18316587 MIP-1 delta expression is increased in RBM (RCC (Renal Cell Carcinoma) bone metastasis) relative to RCC and bone marrow, and may promote RBM-induced osteolysis by stimulating recruitment/differentiation of osteoclast precursors into mature osteoclasts
17303383 These data suggest that Sin1 is a mammalian Ras-inhibitor.
17054722 Sin1 may contribute to ATF-2 signaling specificity by acting as a nuclear scaffold.
17043309 Sin1 together with Rictor are key components of mTORC2 and play an essential role in Akt phosphorylation and signaling
16962653 Results reveal that the SIN1-rictor-mTOR function in Akt-Ser473 phosphorylation is required for TORC2 function in cell survival but is dispensable for TORC1 function.
16919458 Sin1 is necessary for the assembly of TORC2 and for its capacity to phosphorylate Akt/PKB.
15988011 A novel MEKK2-interacting protein, Mip1, that regulates MEKK2 dimerization and activation by forming a complex with inactive and nonphosphorylated MEKK2, was identified.
15722200 The human Sin1 proteins form a complex with Jun N-terminal kinase.
15363842 Results demonstrate that Sin1 transcripts can use alternative polyadenylation signals and describe a number of Sin1 splice variants that potentially encode functionally different isoforms.

AA Sequence

MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSV      1 - 70
DITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQS     71 - 140
ILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLI    141 - 210
CWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLF    211 - 280
VRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFC    281 - 350
LVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKAS    351 - 420
TKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA    421 - 490
STARADYFAQKQRKLNRRTSFSFQKEKKSGQQ                                          491 - 522
//

Text Mined References (42)

PMID Year Title
26235620 2015 A Positive Feedback Loop between Akt and mTORC2 via SIN1 Phosphorylation.
25153992 2014 MAPKAP1 rs10118570 polymorphism is associated with anti-infection and anti-hepatic fibrogenesis in schistosomiasis japonica.
24926550 2014 9q33.3, a stress-related chromosome region, contributes to reducing lung squamous cell carcinoma risk.
24395886 2014 Estradiol and mTORC2 cooperate to enhance prostaglandin biosynthesis and tumorigenesis in TSC2-deficient LAM cells.
24365180 2013 DNA-dependent protein kinase catalytic subunit (DNA-PKcs)-SIN1 association mediates ultraviolet B (UVB)-induced Akt Ser-473 phosphorylation and skin cell survival.
24161930 2013 Sin1 phosphorylation impairs mTORC2 complex integrity and inhibits downstream Akt signalling to suppress tumorigenesis.
23762398 2013 Interaction between NBS1 and the mTOR/Rictor/SIN1 complex through specific domains.
23727834 2013 The Bardet-Biedl syndrome-related protein CCDC28B modulates mTORC2 function and interacts with SIN1 to control cilia length independently of the mTOR complex.
23564492 2013 SIN1 promotes invasion and metastasis of hepatocellular carcinoma by facilitating epithelial-mesenchymal transition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22505404 2012 Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2.
21757730 2011 mSIN1 protein mediates SGK1 protein interaction with mTORC2 protein complex and is required for selective activation of the epithelial sodium channel.
21177249 2011 A new cytosolic pathway from a Parkinson disease-associated kinase, BRPK/PINK1: activation of AKT via mTORC2.
21170086 2011 Genome-wide shRNA screen reveals increased mitochondrial dependence upon mTORC2 addiction.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
18687895 2008 A link between SIN1 (MAPKAP1) and poly(rC) binding protein 2 (PCBP2) in counteracting environmental stress.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18316587 2008 Macrophage inflammatory protein-1 delta: a novel osteoclast stimulating factor secreted by renal cell carcinoma bone metastasis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17303383 2007 Human Sin1 contains Ras-binding and pleckstrin homology domains and suppresses Ras signalling.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17054722 2006 Sin1 binds to both ATF-2 and p38 and enhances ATF-2-dependent transcription in an SAPK signaling pathway.
17043309 2006 Identification of Sin1 as an essential TORC2 component required for complex formation and kinase activity.
16962653 2006 SIN1/MIP1 maintains rictor-mTOR complex integrity and regulates Akt phosphorylation and substrate specificity.
16919458 2006 mSin1 is necessary for Akt/PKB phosphorylation, and its isoforms define three distinct mTORC2s.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16000324 2005 Up-regulation of the ubiquitous alternative splicing factor Tra2beta causes inclusion of a germ cell-specific exon.
15988011 2005 Mip1, an MEKK2-interacting protein, controls MEKK2 dimerization and activation.
15722200 2005 The human stress-activated protein kinase-interacting 1 gene encodes JNK-binding proteins.
15718470 2005 Phosphorylation and regulation of Akt/PKB by the rictor-mTOR complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15363842 2004 Alternative polyadenylation and splicing of mRNAs transcribed from the human Sin1 gene.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
1849280 1991 Expression of three mammalian cDNAs that interfere with RAS function in Saccharomyces cerevisiae.