Property Summary

Ligand Count 80
NCBI Gene PubMed Count 165
PubMed Score 359.16
PubTator Score 269.42

Knowledge Summary

Patent (42,559)

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.500 2.5e-04
astrocytic glioma -1.400 1.5e-02
Astrocytoma, Pilocytic -1.200 3.5e-06
atypical teratoid / rhabdoid tumor -1.500 6.8e-07
ependymoma -1.600 3.1e-02
glioblastoma -1.200 2.3e-06
group 3 medulloblastoma -1.400 9.7e-05
medulloblastoma, large-cell -2.000 1.9e-06
oligodendroglioma -1.100 1.0e-14
ovarian cancer -1.300 4.5e-03
Pick disease -1.100 3.9e-03
pituitary cancer 1.100 8.1e-07
primitive neuroectodermal tumor -1.700 1.1e-04
psoriasis 1.200 1.2e-04
subependymal giant cell astrocytoma -1.382 1.6e-02

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (116)

AA Sequence

MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRA      1 - 70
YRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIHMELDHERMSYLLYQMLCGIK     71 - 140
HLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWS    141 - 210
VGCIMGELVKGCVIFQGTDHIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIF    211 - 280
PSESERDKIKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIE    281 - 350
EWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL    351 - 420
EGCR                                                                      421 - 424
//

Text Mined References (178)

PMID Year Title