Property Summary

NCBI Gene PubMed Count 24
PubMed Score 506.21
PubTator Score 413.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
glioblastoma -2.300 2.5e-05
osteosarcoma 3.329 1.0e-12
ependymoma -1.500 6.5e-12
atypical teratoid / rhabdoid tumor -2.200 1.5e-09
medulloblastoma -1.200 3.6e-07
medulloblastoma, large-cell -1.500 1.2e-04
primitive neuroectodermal tumor -1.100 5.2e-03
juvenile dermatomyositis -1.164 6.2e-08
pediatric high grade glioma -2.100 3.5e-07
pilocytic astrocytoma -1.600 2.5e-09
subependymal giant cell astrocytoma -1.463 1.2e-02
ovarian cancer -1.100 6.7e-06

Gene RIF (2)

PMID Text
21048139 Human IB2 mutation has a role as a contributing genetic factor in chromosome 22-associated cognitive disorders.
12244047 there is a signaling module in which IB2 scaffolds a MLK3/MKK/p38delta kinase cascade.

AA Sequence

MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSLSLGRSEQPHP      1 - 70
ICSFQDDFQEFEMIDDNEEEDDEDEEEEEEEEEGDGEGQEGGDPGSEAPAPGPLIPSPSVEEPHKHRPTT     71 - 140
LRLTTLGAQDSLNNNGGFDLVRPASWQETALCSPAPEALRELPGPLPATDTGPGGAQSPVRPGCDCEGNR    141 - 210
PAEPPAPGGTSPSSDPGIEADLRSRSSGGRGGRRSSQELSSPGSDSEDAGGARLGRMISSISETELELSS    211 - 280
DGGSSSSGRSSHLTNSIEEASSPASEPEPPREPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWL    281 - 350
LSNLVSRMISEGSSPIRCPGQCLSPAPRPPGEPVSPAGGAAQDSQDPEAAAGPGGVELVDMETLCAPPPP    351 - 420
APAAPRPGPAQPGPCLFLSNPTRDTITPLWAAPGRAARPGRACSAACSEEEDEEDDEEEEDAEDSAGSPG    421 - 490
GRGTGPSAPRDASLVYDAVKYTLVVDEHTQLELVSLRRCAGLGHDSEEDSGGEASEEEAGAALLGGGQVS    491 - 560
GDTSPDSPDLTFSKKFLNVFVNSTSRSSSTESFGLFSCLVNGEEREQTHRAVFRFIPRHPDELELDVDDP    561 - 630
VLVEAEEDDFWFRGFNMRTGERGVFPAFYAHAVPGPAKDLLGSKRSPCWVERFDVQFLGSVEVPCHQGNG    631 - 700
ILCAAMQKIATARKLTVHLRPPASCDLEISLRGVKLSLSGGGPEFQRCSHFFQMKNISFCGCHPRNSCYF    701 - 770
GFITKHPLLSRFACHVFVSQESMRPVAQSVGRAFLEYYQEHLAYACPTEDIYLE                    771 - 824
//

Text Mined References (24)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24551779 2012 Evaluation of PKM2 and MAPK8IP2 Polymorphism in Ameloblastic Carcinoma: A Retrospective Quantitative Study.
23225497 2013 Cerebellar and posterior fossa malformations in patients with autism-associated chromosome 22q13 terminal deletion.
21048139 2010 Behavioral and cerebellar transmission deficits in mice lacking the autism-linked gene islet brain-2.
20173330 2010 LRRK2 and the stress response: interaction with MKKs and JNK-interacting proteins.
16456539 2006 A unique set of SH3-SH3 interactions controls IB1 homodimerization.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12524447 2003 The JNK-interacting protein-1 scaffold protein targets MAPK phosphatase-7 to dephosphorylate JNK.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12244047 2002 Fibroblast growth factor homologous factors and the islet brain-2 scaffold protein regulate activation of a stress-activated protein kinase.
12024021 2002 Interaction of Rac exchange factors Tiam1 and Ras-GRF1 with a scaffold for the p38 mitogen-activated protein kinase cascade.
12023290 2002 Differential roles of JIP scaffold proteins in the modulation of amyloid precursor protein metabolism.
11378392 2001 Fibroblast growth factor homologous factors are intracellular signaling proteins.
10827173 2000 Interactions of the low density lipoprotein receptor gene family with cytosolic adaptor and scaffold proteins suggest diverse biological functions in cellular communication and signal transduction.
10756100 2000 cDNA cloning and mapping of a novel islet-brain/JNK-interacting protein.
10629060 2000 Interaction of a mitogen-activated protein kinase signaling module with the neuronal protein JIP3.
10591208 1999 The DNA sequence of human chromosome 22.
10490659 1999 The JIP group of mitogen-activated protein kinase scaffold proteins.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.