Property Summary

NCBI Gene PubMed Count 55
PubMed Score 652.16
PubTator Score 550.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.400 4.9e-03
adult high grade glioma -1.200 1.2e-02
lung carcinoma 2.500 2.4e-34
psoriasis -1.200 1.2e-42

Protein-protein Interaction (11)

Gene RIF (25)

PMID Text
23825109 analysis of the role of JIP1 in APP transport; knockdown of JIP1 did not affect either amyloid precursor protein transport or amyloid-beta peptide production
23770673 Data show that small GTPase RALA regulates formation of a JIP1 (C-Jun-amino-terminal-interacting protein 1) scaffold complex to propagate JNK signaling toward FOXO4 (forkhead box O transcription factor) in response to reactive oxygen species (ROS).
23360921 In resected pancreatic cancer, carriers of a minor allele for rs3824872 (MAPK8IP1) were associated with a survival advantage compared with noncarriers with an additional 2-year survival if both minor alleles were present.
23172226 Lysine 63-linked ubiquitination modulates mixed lineage kinase-3 interaction with JIP1 scaffold protein in cytokine-induced pancreatic beta cell death
21237154 Data suggest that caspase 3-mediated cleavage of JIP1 scaffold proteins may represent an important mechanism for modulation of JNK signalling during apoptotic cell death.
19616077 This review discusses the role of the JIP1 and the c-Jun NH(2)-terminal kinase pathway in the molecular pathogenesis of Alzheimer's and type 2 diabetes. JIP1 is a key regulator of the JNK pathway in neuronal and beta-cells.
19491104 The pathological Tau/JIP1 interaction requires phosphorylation of Tau, and Tau competes with the physiological binding of JIP1 to kinesin light chain.
18480379 Thyroid cancers are characterized by APP upregulation, increased membrane targeting of the APP ectodomain and significantly increased mRNA levels of the APP scaffold proteins JIP1, ShcA and Fe65.
18286207 the activity of JIP1-JNK complexes is downregulated by VRK2 in response to interleukin-1beta
17200414 Binding of JIP1 and FEZ1 to Kinesin-1 is sufficient to activate the motor for microtubule binding and motility.
16301330 the phosphorylation of APP regulates the formation of a pAPP-JIP-1 complex that accumulates in neurites independent of nonphosphorylated APP
15998799 Altogether, our data demonstrate that Akt1 participates in a negative regulatory feedback loop by interacting with the JIP1 scaffold protein.
15911620 JIP1 and JIP3, have a cross-talk that leads to the regulation of the ASK1-SEK1-JNK signal during glucose deprivation; cross-talk between JIP3 and JIP1 is mediated through SEK1-JNK2 and Akt1.
15894166 IB1/JIP-1 participates to the neuronal phenotype of the human LNCaP cells and is a regulator of JNK signaling pathway
15868948 High IGF II expression was followed by high expression of JIP-1 in testicular neoplasms.
15138488 Growth control of prostate cancer cells can be mediated through JNK/c-Jun pathway, but androgen responsiveness can be independent of this pathway; androgen independence in progressive prostate cancer may not occur through activation of this pathway.
14507925 stability is modulated by intracellular calcium
12917434 JIP-1 only facilitated (but is not required for) phosphorylation of Amyloid beta protein precursor but not of the two other family members APLP1 (amyloid precursor-like protein 1) and APLP2
12893827 JIP-1 protein may regulate kinesin-I-dependent neuronal AbetaPP transport, which controls AbetaPP processing
12783873 JIP1 may act as an Akt1 scaffold, which regulates the enzymatic activity of Akt1 and can exert signaling effects independent of JNK activity
12740599 Observational study of gene-disease association. (HuGE Navigator)
12740599 Promoter variant is associated with Alzheimer's disease.
12665528 results suggest that JIP-1b may function as a protein linking the kinesin-I motor protein to the cargo receptor, APP, and that the JNK signaling pathway may regulate the phosphorylation of this cargo protein through the JIP-1b scaffold
12563035 role in promoting transcription of amyloid beta protein precursor
12064607 Data show that mechanical stress of urothelial cells activates in vivo JNK, as a consequence of a regulated expression of IB1/JIP-1, and that urothelial connexin 26 may be directly regulated by the AP-1 complex.

AA Sequence

MAERESGGLGGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISLQCKDTLSLRP      1 - 70
PRAGLLSAGGGGAGSRLQAEMLQMDLIDATGDTPGAEDDEEDDDEERAARRPGAGPPKAESGQEPASRGQ     71 - 140
GQSQGQSQGPGSGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLKTGEQTPPHEH    141 - 210
ICLSDELPPQSGPAPTTDRGTSTDSPCRRSTATQMAPPGGPPAAPPGGRGHSHRDRIHYQADVRLEATEE    211 - 280
IYLTPVQRPPDAAEPTSAFLPPTESRMSVSSDPDPAAYPSTAGRPHPSISEEEEGFDCLSSPERAEPPGG    281 - 350
GWRGSLGEPPPPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASVS    351 - 420
SPYESAIGEEYEEAPRPQPPACLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCIINGEEQE    421 - 490
QTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKN    491 - 560
SDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEISVRGVKIGVKADDSQEA    561 - 630
KGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVE    631 - 700
YTCPTEDIYLE                                                               701 - 711
//

Text Mined References (56)

PMID Year Title
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23825109 2013 Loss of c-Jun N-terminal kinase-interacting protein-1 does not affect axonal transport of the amyloid precursor protein or A? production.
23770673 2013 The small GTPase RALA controls c-Jun N-terminal kinase-mediated FOXO activation by regulation of a JIP1 scaffold complex.
23360921 2013 Survival is associated with genetic variation in inflammatory pathway genes among patients with resected and unresected pancreatic cancer.
23172226 2013 Lysine 63-linked ubiquitination modulates mixed lineage kinase-3 interaction with JIP1 scaffold protein in cytokine-induced pancreatic ? cell death.
21237154 2011 Disassembly of the JIP1/JNK molecular scaffold by caspase-3-mediated cleavage of JIP1 during apoptosis.
19616077 2009 Role of the JNK-interacting protein 1/islet brain 1 in cell degeneration in Alzheimer disease and diabetes.
19491104 2009 Phosphorylated Tau interacts with c-Jun N-terminal kinase-interacting protein 1 (JIP1) in Alzheimer disease.
18480379 2008 Evidence for a role of the amyloid precursor protein in thyroid carcinogenesis.
18286207 2008 Modulation of interleukin-1 transcriptional response by the interaction between VRK2 and the JIP1 scaffold protein.
17709393 2007 Vaccinia-related kinase 2 modulates the stress response to hypoxia mediated by TAK1.
17200414 2007 Two binding partners cooperate to activate the molecular motor Kinesin-1.
16840345 2006 Vaccinia virus B1R kinase interacts with JIP1 and modulates c-Jun-dependent signaling.
16301330 2005 Coordinated transport of phosphorylated amyloid-beta precursor protein and c-Jun NH2-terminal kinase-interacting protein-1.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
16195223 2006 Hyperphosphorylation of JNK-interacting protein 1, a protein associated with Alzheimer disease.
15998799 2005 Dissociation of Akt1 from its negative regulator JIP1 is mediated through the ASK1-MEK-JNK signal transduction pathway during metabolic oxidative stress: a negative feedback loop.
15911620 2005 Cross-talk between JIP3 and JIP1 during glucose deprivation: SEK1-JNK2 and Akt1 act as mediators.
15894166 2005 IB1/JIP-1 controls JNK activation and increased during prostatic LNCaP cells neuroendocrine differentiation.
15868948 The JNK interacting protein JIP-1 and insulin like growth factor II genes are co-expressed in human embryonic tumours.
15138488 2004 JNK interacting protein 1 (JIP-1) protects LNCaP prostate cancer cells from growth arrest and apoptosis mediated by 12-0-tetradecanoylphorbol-13-acetate (TPA).
14507925 2003 Calcium- and proteasome-dependent degradation of the JNK scaffold protein islet-brain 1.
12937412 2003 A peptide inhibitor of c-Jun N-terminal kinase protects against excitotoxicity and cerebral ischemia.
12917434 2003 Amyloid beta protein precursor is phosphorylated by JNK-1 independent of, yet facilitated by, JNK-interacting protein (JIP)-1.
12893827 2003 Amyloid beta protein precursor (AbetaPP), but not AbetaPP-like protein 2, is bridged to the kinesin light chain by the scaffold protein JNK-interacting protein 1.
12783873 2003 JNK-interacting protein 1 promotes Akt1 activation.
12756254 2003 Recruitment of JNK to JIP1 and JNK-dependent JIP1 phosphorylation regulates JNK module dynamics and activation.
12740599 2003 Islet-brain1/C-Jun N-terminal kinase interacting protein-1 (IB1/JIP-1) promoter variant is associated with Alzheimer's disease.
12665528 2003 A scaffold protein JIP-1b enhances amyloid precursor protein phosphorylation by JNK and its association with kinesin light chain 1.
12563035 2003 JNK-interacting protein-1 promotes transcription of A beta protein precursor but not A beta precursor-like proteins, mechanistically different than Fe65.
12524447 2003 The JNK-interacting protein-1 scaffold protein targets MAPK phosphatase-7 to dephosphorylate JNK.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12194869 2002 Akt1 regulates a JNK scaffold during excitotoxic apoptosis.
12064607 2001 Connexin26 is regulated in rat urothelium by the scaffold protein IB1/JIP-1.
12024021 2002 Interaction of Rac exchange factors Tiam1 and Ras-GRF1 with a scaffold for the p38 mitogen-activated protein kinase cascade.
11912189 2002 Interaction of Alzheimer's beta -amyloid precursor family proteins with scaffold proteins of the JNK signaling cascade.
11790792 2002 alpha-Synuclein protects against oxidative stress via inactivation of the c-Jun N-terminal kinase stress-signaling pathway in neuronal cells.
11726277 2001 Mixed lineage kinase LZK forms a functional signaling complex with JIP-1, a scaffold protein of the c-Jun NH(2)-terminal kinase pathway.
11724784 2002 Jun NH2-terminal kinase (JNK) interacting protein 1 (JIP1) binds the cytoplasmic domain of the Alzheimer's beta-amyloid precursor protein (APP).
11700324 2002 Phosphorylation of Pax2 by the c-Jun N-terminal kinase and enhanced Pax2-dependent transcription activation.
11585908 2001 The transcriptional repressor REST determines the cell-specific expression of the human MAPK8IP1 gene encoding IB1 (JIP-1).
11517249 2001 c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK.
11238452 2001 Cargo of kinesin identified as JIP scaffolding proteins and associated signaling molecules.
11147798 2001 Cell-permeable peptide inhibitors of JNK: novel blockers of beta-cell death.
10827173 2000 Interactions of the low density lipoprotein receptor gene family with cytosolic adaptor and scaffold proteins suggest diverse biological functions in cellular communication and signal transduction.
10748095 2000 IB1 reduces cytokine-induced apoptosis of insulin-secreting cells.
10700186 2000 The gene MAPK8IP1, encoding islet-brain-1, is a candidate for type 2 diabetes.
10629060 2000 Interaction of a mitogen-activated protein kinase signaling module with the neuronal protein JIP3.
10574993 1999 Interaction of c-Jun amino-terminal kinase interacting protein-1 with p190 rhoGEF and its localization in differentiated neurons.
10490659 1999 The JIP group of mitogen-activated protein kinase scaffold proteins.
9933567 1999 Genomic organization, fine-mapping, and expression of the human islet-brain 1 (IB1)/c-Jun-amino-terminal kinase interacting protein-1 (JIP-1) gene.
9733513 1998 A mammalian scaffold complex that selectively mediates MAP kinase activation.
9442013 1998 IB1, a JIP-1-related nuclear protein present in insulin-secreting cells.
9235893 1997 A cytoplasmic inhibitor of the JNK signal transduction pathway.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.