Property Summary

NCBI Gene PubMed Count 691
PubMed Score 5333.94
PubTator Score 2545.41

Knowledge Summary

Patent (203,280)

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma 1.466 6.4e-05
posterior fossa group B ependymoma -1.200 1.1e-08
glioblastoma -1.400 3.7e-04
group 4 medulloblastoma 1.900 2.6e-04
atypical teratoid/rhabdoid tumor -1.500 1.3e-04
tuberculosis -1.900 2.5e-07
intraductal papillary-mucinous carcinoma... 1.100 7.3e-03
adult high grade glioma -1.600 5.3e-06
pilocytic astrocytoma -1.300 1.5e-07
spina bifida -1.508 3.9e-02
Breast cancer -1.200 1.7e-12
acute myeloid leukemia 2.000 4.8e-02
ovarian cancer 1.200 5.0e-08

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (606)

PMID Text
26988982 These results indicate that IL-17A enhances COX2 expression and PGE2 production via the p38/c-Fos and JNK/c-Jun signalling pathways in NP cells to mediate intervertebral disc inflammation.
26988444 The crystal structure of JNK1 bound to the catalytic domain of MKP7 at 2.4-A resolution, providing high-resolution structural insight into the FXF-docking interaction, is reported.
26928204 Uniaxial stretch activates JNK1 via RhoA and ROCK pathways in human bladder smooth muscle cells.
26838722 Streptococcus pyogenes toxin NAD glycohydrolase elicits necrosis through two different mechanisms depending on its NADase activity, i.e., metabolic (NADase(+)) or programmed (NADase(-)) via JNK1 activation.
26792731 cAMP signaling increases HDAC8 protein levels by reducing JNK-mediated autophagy and ubiquitin-proteasome-dependent degradation of the HDAC8 protein in H1299 lung cancer cells.
26718614 The present study demonstrated that oxLDL positively regulates miR-146a via the JNK and NF-kappaB pathways in macrophages, and that miR-146a inhibits inflammatory activation.
26708719 In hepatocytes, JNK1 and JNK2 appear to have combined effects in protecting from drug-induced liver injury.
26694167 results suggest that baicalein-mediated ASK1/JNK activation regulates the mitochondria-dependent apoptosis pathway through the up-regulation of TAp63 and down-regulation of NF-kappaB and CD74/CD44 in B-cell malignancies
26668357 Data show that caspase recruitment domain-containing protein 11/B-cell CLL/lymphoma 10/mucosa-associated lymphoid tissue lymphoma translocation gene 1 signaling drives lymphoproliferation through NF-kappa B and c-Jun N-terminal kinase activation.
26667302 Negative feedback regulation of AXL by miR-34a modulates apoptosis in lung cancer cells by activating the transcription factor ELK1 via the JNK signaling pathway.
26648552 targeting JNK signaling favors TGF-beta to block HBx-induced cell growth promotion in well-differentiated HCC cells. As an adjunct to anti-viral therapy, the combination of TGF-beta and inhibition of JNK signaling is a potential therapy for HBV-infected HCC.
26575790 Data suggest that repression of JNK-c-Jun signaling through pancreatic polypeptide receptor 1 (PP1) is one of the key anti-tumor mechanisms of neuronal membrane cytoskeletal protein 4.1 (4.1N).
26573109 Knockdown of endogenous EGR-1 by small interfering RNA (siRNA) somewhat reduced Tax-mediated JNK-1 transcription.
26559961 These data demonstrated a critical role of the JNK protein in the regulation of H5N1 influenza A virus RNA and protein synthesis during virus infection.
26519559 novel regulation of TAp63gamma transactivity and pro-apoptotic activity mediated by JNK1
26503828 Phloretin is able to inhibit NSCLC A549 cell growth by inducing apoptosis through P38 MAPK and JNK1/2 pathways, and therefore may prove to be an adjuvant to the treatment of non-small cell lung cancer
26429914 GSTP1 tyrosine phosphorylation by EGFR controls the interaction of GSTP1 with JNK and Apoptosis in Brain Tumor Cells.
26418950 JNK/c-Jun activation and BIM induction is a late pro-apoptotic response of glioma cells treated with alkylating anticancer drugs.
26397194 These results suggest that ITCs could be potential agents for the prevention of C6 glioma cell migration and invasion by decreasing FAK/JNK-mediated MMP-9 expression
26352010 Results indicate that L. mexicana amastigotes have the capacity to diminish MAP kinases p38 and JNK activation and activate PI3K and AKT pathways, which is probably one of the strategies employed by L. mexicana amastigotes to inhibit apoptosis in the infected monocyte-derived dendritic cells.
26296767 Hepatitis C virus -induced ROS/JNK signalling transcriptionally activates Bim expression, which leads to Bax activation and apoptosis induction.
26286024 Data show that proto-oncogene protein B-raf (BRAF) inhibition induces c-Jun N-terminal kinase (c-JUN) expression and c-JUN abundance and activation by down-regulating SPRY2/4 protein expression.
26270987 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
26258887 The PARP14-JNK1-PKM2 regulatory axis is an important determinant for the Warburg effect in tumour cells and provides a mechanistic link between apoptosis and metabolism.
26235742 Inhibition of JNK1/2 activity suppressed Hedgehog pathway activity in acquired chemoresistant cancer cells.
26204503 It was shown that newly synthesized H2O2 invigorates the phosphorylation and action of ERK-1/Erk2 in E. coli phagocytosis, while phospho-JNK and phospho-p38 appear to regulate H2O2 production.
26165348 NFkappaB and JNK inhibition increased the autophagy expression in inflammatory conditions.
26157010 These datauncovered a kinetically distinct role for the JNK pathway in defining the transcriptome that underlies mesenchymal identity and revealed novel transcription factors that mediate epithelial to mesenchymal transition.
26134032 H/R activates ROS/Egr-1 signaling pathway in H9c2 cells, and JNK activation plays an important role in this pathway
26095851 Cyclophilin A regulates JNK/p38-MAPK signaling through its physical interaction with ASK1.
26058961 MAPK8-mediated stabilization of SP1 is essential for RUNX1-RUNX1T1 - driven leukaemia.
26053095 Data show that the protein phosphatase 2A (PP2A)/c-jun N-Terminal Kinase (JNK)/Sp1 transcription factor/CDK1 kinase pathway and the autophagy/cyclin kinase inhibitor p21 pathway participated in G2/M cell cycle arrest triggered by PP2A inhibitors.
26031809 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
25955534 our data suggested that the JNK-Bcl-2 pathway was the critical regulator of gartanin-induced protective autophagy and a potential drug target for chemotherapeutic combination.
25943894 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
25896662 MNQ induced apoptosis of A549 cells independent of cell cycle arrest, and is mediated by the JNK and p38 MAPK signaling pathways.
25847947 Ectopic expression of wild-type DUSP4, but not of a phosphatase-deficient mutant, dephosphorylates c-JUN N-terminal kinase (JNK) and induces apoptosis in DLBCL cells.
25792289 These data suggest that JNK1/2 may play an important role in promoting the replication of Penicillium marneffei.
25779847 treatment with Ang-(1-7) promoted cholesterol efflux in Ang II-treated THP-1 macrophages, partly through inactivation of p38 and JNK signaling and by inducing the expression of PPARg and LXRa.
25737554 The crystal structure of JNK1 in complex with the second docking site of MKK7, was determined, revealing two different binding modes of the docking motif correlating with observations from NMR exchange spectroscopy.
25726846 Data show that silencing of c-Jun N-terminal kinase (JNK) ablated the high-mobility group box-1 (HMGB1)-induced proliferation in pulmonary arterial smooth muscle cells (PASMC).
25583514 impaired Hippo signaling induces JNK activation through Rho1.
25546243 low levels of active JNK is significantly associated with the presence of IL-1beta in stage III melanoma.
25526895 MUC1 mediates autocrine TGF-beta signaling by activating the JNK/AP-1 pathway in hepatocellular carcinoma cells.
25504636 Inhibition of GSK3beta attenuated the migration and invasion of glioblastoma cells associated with suppression focal adhesion kinase, guanine nucleotide exchange factors/Rac1 and c-Jun N-terminal kinase.
25502879 PpIX induces a necrotic cell death in THP-1 macrophages through ROS production, JNK activation, and mPTP opening
25501809 JNK-mediated phosphorylation of WDR62 T1053 negatively regulated microtubule association, and loss of JNK signaling resulted in constitutive WDR62 localization to microtubules irrespective of cell cycle stage.
25496033 FXR may regulate SOD3 expression to suppress reactive oxygen species production, resulting in decreasing JNK activity.
25456131 suppression of tumorigenesis by JNK requires ATF2.
25423287 although JNK activation and RIP3 expression are induced by FS, neither contributes to the liver injury.
25415535 Studies indicate that the c-Jun N-terminal kinases are implicated in numerous diseases ranging from central nervous system (CNS) disorders to inflammation and cancer.
25353341 Phosphorylation of sterol regulatory element-binding protein (SREBP)-1c by p38 kinases, ERK and JNK
25341038 Stress-activated JNK phosphorylates TAp73 at multiple serine and threonine residues, which is crucial to ablate TAp73/MDM2 complex and to promote TAp73 transcriptional function and induction of robust apoptosis.
25316285 High JNK expression is associated with breast cancer.
25288801 Data suggest a role for the mitogen-activated protein kinase kinase kinase 7 TAK1-jun-NH2-Terminal Kinase JNK pathway as a critical regulator of NLRP3 protein inflammasome activation.
25270024 Therefore, our study demonstrates that MAPK members (ERK1/2 and JNK) play a key role in CCR7 regulating SCCHN metastasis.
25254627 Activated mTORC1 elicits IL8 gene expression via the activation of an IRE1-JNK signalling cascade.
25233933 miR-196 performed it's their function by inhibiting NME4 expression and further activating p-JNK, suppressing TIMP1, and augmenting MMP1/9.
25218495 Data indicate that focal adhesion kinase (FAK) and jun-NH2-terminal kinase (JNK) are the key downstream effectors of heat-shock protein GRP78.
25164676 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
25160932 B-cell activation together with the increase of AID mRNA expression and the subsequent class switch recombination (CSR) in HIV-exposed B cells occurred through spleen tyrosine kinase (SYK) and c-Jun N-terminal kinase (JNK) pathways.
25143627 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
25116390 Collectively, these data reveal that activation of the PI3K/Akt pathway limits JNK-mediated apoptosis by phosphorylating and inactivating ASK1 during human enterovirus 71 infection.
25113506 Inhibition of uPAR down-regulated the phosphorylation of FAK, ERK and JNK in colon cancer cells.
25077544 JNK1/2 regulate Bid by direct phosphorylation at Thr59.
25068797 Findings suggest that methyl isocyanate inhibits angiogenesis by inducing mitogen-activated protein kinase kinase kinase 5 ASK1-JNK-dependent endothelial cell death.
25064159 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
25043814 This study identified an NBR1-MEKK3 complex as a key regulator of JNK signaling and adipose tissue inflammation in obesity.
24984152 results demonstrate that HKa accelerates the onset of EPC senescence by stimulating JNK/FOXO4/MnSOD pathway, its effect is mediated by the HC
24970676 Tunicamycin increased the misfolded proteins that lead to the activation of endoplasmic reticulum stress-mediated protection and induced apoptosis paralleled by autophagy in breast cancer cells which was regulated by IRE1/JNK/beclin-1.
24963148 RIP3-dependent necroptosis mediates non-alcoholic steatohepatitis-induced liver fibrosis via activation of JNK, MCP-1-mediated recruitment of monocytes, and an expansion of intrahepatic biliary/progenitor cells.
24947996 Data suggest that the K-Ras - JNK1/2 axis could be a potential target in cancer stem cells (CSCs) or proliferating cancer stem-like cells (CSLCs)-directed therapies against pancreatic cancer.
24936061 identified NMI induction as a novel negative feedback mechanism that decreases IRE1alpha-dependent activation of JNK and apoptosis in cytokine-exposed beta cells
24927726 This study demonstrates that ionizing radiation modulates ligand-responsive TLR expression through the JNK pathway, depending on differentiation state.
24914133 Data indicate that hydroxyurea (HU) induces SAR1 protein expression, which in turn activates gamma-globin expression, predominantly through the Gialpha/JNK/Jun pathway.
24906853 JNK1/2 and p38 MAPK signaling pathways are beneficial to enterovirus 71 infection and positively regulate secretions of inflammatory cytokines in dendritic cells.
24901053 depletion of alphaNAC in multiple types of cancer cells induce typical apoptotic cell death. This anti-apoptotic function is mediated by the FADD/c-Jun N-terminal kinase pathway.
24874739 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
24862326 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
24825906 CNK1 mediates ephrinB1 signaling that promotes cell migration through RhoA and JNK activity.
24820448 During free radical stress, hUCBC paracrine factors activate myocyte Akt, which increases myocyte viability by decreasing activation of death-promoting protein kinases JNK and p38.
24787013 activation of p38 and JNK pathways may revert resistance of TP53-mutated cells to spindle poisons.
24699410 Overexpression of uPAR and cathepsin B increases expression of cytosolic p-JNK.
24679696 Expression of JNK and c-Jun are significantly reduced in septic patients and correlate inversely with protein phosphatase type 2A expression.
24661418 Activation of JNK1 suppresses fibroblast elastogenesis during the alveolar stage of lung development.
24642040 Data indicate that receptor-interacting protein kinase 2 (RIP2) is an activator of the NF-kappa B and c-Jun N-terminal kinase pathways.
24589734 STMN and SCG10 are similarly targeted by JNK but there are clear differences in JNK recognition and phosphorylation of the closely related family member, SCLIP.
24587347 JNK contributes to the tumorigenic potential of human cholangiocarcinoma cells through the mTOR pathway regulated GRP78 induction.
24556843 MiR-4782-3p inhibited cell proliferation in NSCLC by targeting USP14, ZEB2 and XIAP.
24515990 MAPK8 expression is associated with a quantitative trait locus in patients with sickle cell disease and pulmonary hypertension.
24515257 Transforming growth factor-beta1 downregulates vascular endothelial growth factor-D expression in human lung fibroblasts via the Jun NH2-terminal kinase signaling pathway
24502975 Notably, NAADP-mediated Ca(2+) release in intact cells is regulated by Mg(2+), PI(3,5)P2, and P38/JNK kinases, thus paralleling regulation of TPC2 currents.
24457963 c-Jun N-terminal kinase is activated at the spine prior to the onset of in Alzheimer disease.
24452601 These findings suggest for the first time that FOXO1 is a promising candidate substrate for JNK, and the FOXO1-dependent DNA damage repair may be regulated positively by the JNK pathway in H1299 lung cancer cells.
24434780 Comparisons between the HD fibroblast gene signature and breast cancer tumor stroma revealed that JNK1 stress signaling is the single most significant biological process that is shared between these 2 data sets.
24418364 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
24366007 these results suggest that nutlin-3 induces HO-1 expression via the activation of both JNK which is dependent on ROS generated by p53 translocated to the mitochondria and p38 MAPK which appears to be stimulated by a ROS-independent mechanism
24335928 Our results imply that mesenchymal JNK has a pivotal role in the paracrine cross talk between dermal fibroblasts and epidermal keratinocytes during wound healing.
24316756 High JNK1 expression is associated with resistance to temozolomide in stem-like glioblastoma.
24225136 Data indicate that miltefosine and erufosine induced dephosphorylation of Akt and phosphorylation of JNK in cutaneous T-cell lymphoma cell line.
24184208 Enhanced interactions of stress-activated JNK1 with scaffold and substrate proteins throughout the nucleus and the cytosol under conditions of hyperosmotic stress, are reported.
24170769 we report that sorafenib suppresses UV-induced apoptosis specifically by inhibiting c-jun-NH(2)-kinase (JNK) activation through the off-target inhibition of leucine zipper and sterile alpha motif-containing kinase (ZAK)
24127566 Phosphorylation of moesin at Thr558 by JNK is important for podosome rosette formation.
24091673 Asymmetric dimethylarginine treatment of colon adenocarcinoma cell line, attenuated serum starvation-induced apoptosis and suppressed the activation of the Fas (APO-1/CD95)/JNK pathway.
24086554 Leads to dephosphorylation and inactivation of JNK.
24073601 This study indicates that increased expression of c-Fos, p-c-Jun, members of AP-1 transcriptional factor and p-JNK is associated with neuronal degeneration in the ganglion cell layer of retinas in diabetic patients.
24055030 MUC1 directly binds to JNK1 through the MUC1-CD (amino acids 1-45) region.
24044867 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
24040019 Data show that buthionine sulfoximine and synergizes with hydroxychavicol in inducing apoptosis of chronic myeloid leukemic (CML) cells through the GSH-ROS-JNK-ERK-iNOS pathway by apoptosis inducing factor (AIF)-dependent manner.
24037431 Jnk1 in hepatic stellate cells, but not in hepatocytes, significantly contributes to liver fibrosis development.
24023291 GIC lines and their derived differentiated cultures expressed CD95 on the cell surface and were sensitive towards APO010-mediated cell death to a variable extent
24023255 A molecular mechanism linking JNK activity to Yki regulation. JNK can promote YAP activity in mammalian cells.
24008433 Low c-jun Amino-Terminal Kinase is associated with glioblastoma.
23981301 Study describes a novel JNK substrate that emerged from analysis of the human genome, the functionally uncharacterized protein smoothelin-like 2 (SMTNL2). SMTNL2 protein bound with high-affinity to multiple MAPKs including JNK1-3 and ERK2; SMTNL2 protein was expressed in many mammalian tissues, with a notably high expression in skeletal muscle.
23922701 Dysregulation of pol iota by JNK/c-Jun is involved in carcinogenesis and offer a novel understanding of the role of pol iota or c-Jun in mutagenesis.
23916702 mechanical stretch can promote magnitude-dependent proliferative modulation through PKC and possibly JNK but not via p38MAPK in human bladder smooth muscle cells.
23912840 JNK is specifically involved in the maintenance of the tumor initiating capacity of A549 Non-small cell lung cancer cells.
23906792 CTGF acting through Rac1 activates the MLK3/JNK signaling pathway, which in turn initiates AP-1 activation and recruitment of c-Jun and c-Fos to the collagen I promoter and ultimately induces collagen I expression in human lung fibroblasts
23900681 downregulation of MOR may activate JNK signal transduction pathway via regulating MKK7 phosphorylation level so as to inhibit the proliferation of hepatoma carcinoma cells and cause tumor growth retardation.
23900581 JNK-1 and JNK-2 may be involved in the chemoresistance observed in prostate cancer cells treated with cisplatin and blocking the stimulation of Jun kinase signaling may be important for regulating the susceptibility to cisplatin of prostate cancer.
23891538 Results suggest that IFN-gamma-mediated IL-27 protein but not IL-27p28 gene expression is positively regulated by the C-Jun N-terminal kinases (JNK), mitogen-activated protein kinases (MAPKs) and the phosphoinositide 3-kinase (PI3K).
23863879 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
23861391 SH3BP5 binds to JNK and directly inhibits JNK through its two putative mitogen-activated protein kinase interaction motifs (KIMs).
23857473 these results indicate that CAPE potentiated TRAIL-induced apoptosis in SK-Hep1 cells, through upregulation of TRAIL receptors via modulation of p38 and JNK signaling pathways
23817665 b-elemene blocked the cisplatin-stimulated increase in the level of phosphorylated c-Jun NH2-terminal kinase (JNK) in these cells
23799149 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
23770673 Data show that small GTPase RALA regulates formation of a JIP1 (C-Jun-amino-terminal-interacting protein 1) scaffold complex to propagate JNK signaling toward FOXO4 (forkhead box O transcription factor) in response to reactive oxygen species (ROS).
23762317 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
23715767 Transcription of the p21Waf1/Cip1 and JNK-1 genes is affected by inhibition of the early growth response-1(Egr-1).
23712703 Data indicate that HMGB1-induced the release of inflammation cytokines including TNF-alpha, IL-8, IL-10, and MCP-1 in bronchial epithelial cells through activating RAGE/JNK/NF-kappaB p65 pathway.
23662689 crosstalk between JNK and Fas pathway in radiation-induced apoptosis
23615449 Data indicate JNK1/2 as a central key molecule in the detrimental effects of interleukin-1beta (IL-1beta).
23608534 a role for a RACK1/JNK/eEF1A2 complex in the quality control of newly synthesized polypeptides in response to stress
23608488 Activation of JNK by IL-4 and IL-1 cytokines individually is inhibited by the combination.
23603344 The absolute mRNA content of paraffin embedded samples of salivary gland cancer was determined by quantitative reverse transcription-PCR using specific primers for NFkB1, GADD45A and JNK1.
23580093 Activation of ASK1/JNK signaling pathways by oridonin induces growth inhibition and apoptosis in cultured HuH-6 cells.
23555914 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
23440494 silencing of FANCF increased cell apoptosis of OVCAR3 cells which was caused by activated Jun N-terminal kinase (JNK).
23416355 Aiming to characterise the nature of JNK1beta1 phosphorylation by active MKK4 using mass spectrometry, a recognised yet uncharacterised phospho-site (S377) as well as two novel phospho-residues (T228 and S284) were identified.
23393199 Data indicate that von Hippel-Lindau (VHL)-deficient clear cell renal cell carcinomas (RCC) are dependent upon c-Jun-NH(2)-kinase (JNK) activity for in vitro and in vivo growth.
23359252 The role of beta1 integrins and of a beta1 downstream target, c-Jun amino-terminal kinase 1 (JNK1), in regulating radiation-induced apoptosis in prostate cancer was studied.
23326144 c-Jun N-terminal kinase has a critical role in thermotherapy-induced apoptosis in human gastric cancer cells
23290789 Results suggest that Tgase-2/PP2A/JNK might be a novel axis that affects N-cadherin switching in the epithelial-mesenchymal-transition (EMT) of A549 lung cancer cells.
23273084 We observed that the JNK1 gene and the phosphorylated expression of JNK1 and JNK2 were upregulated in the skin of patients with hypospadias compared with that in the normal prepuce in the levels of mRNA and protein, respectively.
23258237 TNF-alpha stimulates tissue repair functions of HPAECs. This may be mediated, at least in part, positively via JNK & ERK1/2. This may play a role in endothelial cell-mediated tissue repair, especially in an inflammatory milieu where TNF-alpha is present.
23237571 activation of JNK promotes development of pancreatic cancer
23077074 Glucagon-like peptide-1 counteracts oxidative stress-dependent apoptosis of human cardiac progenitor cells by inhibiting the activation of the c-Jun N-terminal protein kinase signaling pathway
23056263 Data indicate that Khz preferentially induces apoptosis in cancer cells involving an increase in calcium level, JNK activation, and reactive oxygen species generation via NADPH oxidase and mitochondria.
23051914 These results reveal a critical role for the MAPK8 activation pathway through TRAF2 and RIPK1 for TNFSF10-induced autophagy that blunts apoptosis in cancer cells.
23020677 Fully buried Cys C137 and C213 are involved in tightly filled hydrophobic core. Mutation of these was found to correlate with thermal stability and enzyme activity.
22942770 sustained osmotic cell shrinkage per se was found to trigger phosphorylation of JNK and p38, caspase activation, and cell death.
22920299 adduct formed by GSH and the strong GSTP1-1 inhibitor NBDHEX abolishes the interaction between GSTP1-1 and JNK1alpha2.
22902540 IL1beta treatment reduces SHBG production in HepG2 cells by the down-regulation of HNF-4A via the MAPK kinase (MEK)-1/2 and c-Jun N-terminal kinase (JNK) MAPK signaling pathways.
22870247 Definitely, inhibition of the JNK1/c-jun pathway is useful for reversing ABCG2-mediated drug resistance in HCPT-resistant colon cancer cells
22850273 These findings suggest that JNK activation and BLyS expression in multiple myeloma (MM) cells may form a positive feedback loop that promotes the survival and proliferation of MM cells.
22844345 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
22766602 Downregulation of JNK1 expression by siRNA against JNK1 mRNA induces apoptotic signaling in prostate cancer PC-3 cells.
22763043 Data suggest that Wnt5a activates monocytic cells via JNK and NF-kappaB activation.
22749438 Results indicate that polymyxin B (PMB)-induced hepatocyte growth factor (HGF) production and proliferation of human dermal fibroblasts and suggest that activation of mitogen-activated protein kinases is involved in the induction of HGF production.
22729748 FKB inducted apoptosis, which was associated with cytochrome c release, caspase-7 and caspase-9 activation and Bcl-xL/Bax dys-regulation. The JNK inhibitor SP600125 significantly decreased the growth-inhibitory and apoptotic effects of FKB.
22689214 role of HSP70 and 90 in modulation of JNK, ERK expression in preeclamptic placental endothelial cell
22509080 Data show that HBx can induce HepG2 cell apoptosis via a novel active MLK3-MKK7-JNKs signaling module to upregulate FasL protein expression.
22506718 The activation of both JNK and p38 mitogen-activated protein kinase mechanotransduction cascades is a crucial intracellular mechanism that mediates cyclooxygense-2/prostaglandin E2 and inducible NO synthase/nitric oxide production.
22493490 Ectopic expression of human MutS homologue 2 on renal carcinoma cells is induced by oxidative stress with interleukin-18 promotion via p38 mitogen-activated protein kinase (MAPK) and c-Jun N-terminal kinase (JNK) signaling pathways.
22493283 found that osmotic stress activates mTORC1 kinase activity in a JNK-dependent manner. Our findings suggest that the molecular link between JNK and Raptor is a potential mechanism by which stress regulates the mTORC1 signaling pathway
22456510 Ser409, located within the pol-eta binding domain of Rad18, is phosphorylated by c-jun kinase in response to dna damage, promoting the interaction between Rad18 and pol-eta.
22450687 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
22447977 IL-15 can signal via IL-15Ralpha, JNK, and NF-kappaB to drive RANTES production by myeloid cells.
22446103 Data suggest that activated/phosphorylated JNK1 colocalizes with estrogen receptor alpha at many target gene promoters in nuclei of breast cancer cells exposed to estrogens.
22435755 PKC-delta mediates interferon-alpha-induced apoptosis through JNK1 activation.
22433870 novel roles for CAV1 variants in cell death; wtCAV1 promotes cell death, whereas CAV1beta promotes cell survival by preventing inactivation of BCL2 and BCLxL via JNK in paclitaxel-mediated apoptosis.
22394200 The dual effect of JNK can efficiently trigger Puma activation and apoptosis in chemoresistant ovarian cancer cells.
22363806 JNK mediates the expression of CTGF and corneal scarring in corneal wound healing.
22357202 Inhibition of extracellular signal regulated kinase 1/2 and c-jun N-terminal kinases increases, but that inhibition of p38 mitogen-activated protein kinase decreases M. tuberculosis-induced CD44 surface expression in THP-1 human monocytes.
22351776 We report the kinetic mechanism for JNK1beta1 with transcription factors ATF2 and c-Jun along with interaction kinetics for these substrates; JNK1beta1 followed a random sequential mechanism forming a ternary complex between JNK-substrate-ATP.
22283740 Silibinin dose-dependently promoted the expression of phosphorylated-c-Jun N-terminal kinase. Inhibition of JNK by SP600125 decreased ROS generation. NAC down-regulated the expression of p-JNK, indicating that JNK could be activated by ROS.
22184250 The repression of TNF-alpha-induced JNK activation by Miz1 is de-repressed by its own site-specific ubiquitination and degradation.
22171160 TRPV1 induced increases in IL-6/IL-8 release occur through TAK1 activation of JNK1-dependent and JNK1-independent signaling pathways.
22164242 SUMOylation may significantly contribute to modulation of JNK activation and contribute to cell death in oxidative stress conditions
22154358 Data suggest aberrant MAP2K protein (MKK3, MKK4, MKK6, and MKK7) expression indicates that altered cellular signal transduction mediated via JNK and p38 may be common in bladder cancer.
22114267 Activation of the c-Jun N-terminal protein kinase (JNK) transgene is essential for mediating the apoptotic response of neurons to amyloid-beta peptide.
22100391 phosphorylation of the M3/6 phosphatase by JNK in response to stress stimuli results in attenuation of phosphatase activity and acceleration of JNK activation
22087220 study implicates a G12-stimulated mitogen-activated protein kinase cascade in cancer cell invasion, and supports a role for JNK in cancer progression.
22021110 The anti-proliferative effect of EORP(extract of Reishi polysaccharides) was partly mediated by downregulation of PDGF-induced JNK phosphorylation
22014979 involvement of JNKs in TM4SF5-mediated p27(Kip1) Ser10 phosphorylation and localization during epithelial-mesenchymal transition.
22005259 Reactive oxygen species accumulation and G2/M cell cycle arrest contributed to the apoptosis process through the TNF-alpha, NF-kappaB, JNK and p53 regulation pathway in HepG2 cells treated with tubeimoside-1.
21984578 Findings suggest that local IFN production may interact with a genetic factor (PTPN2) to induce aberrant proapoptotic activity of the BH3-only protein Bim, resulting in increased beta-cell apoptosis via JNK activation and the intrinsic apoptotic pathway.
21964465 our studies have revealed a new role for JNK1 in determining gene regulatory outcomes by estrogen receptor alpha
21959987 Hypoxia-induced migration of HSC/MFs involves an early, mitochondrial-dependent ROS-mediated activation of ERK and JNK, followed by a delayed- and HIF-1alpha-dependent up-regulation and release of VEGF.
21948112 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
21943220 Ceramide could induce autophagy in human nasopharyngeal carcinoma cells, and activation of JNK pathway was involved in ceramide-induced autophagy and LC3 expression.
21931671 Data show that mda-7/IL-24 activation leads to upregulation of growth arrest and DNA damage inducible (GADD) 45 alpha and gamma and JNK activation.
21863240 JNK1-dependent increase in labile iron pool is mediated by Itch ubiquitin ligase.
21856198 JNK1 phosphorylation of Cdt1 inhibits recruitment of HBO1 histone acetylase and blocks replication licensing in response to stress
21822690 regulation of negative regulation of JNK-1 upon contact inhibition is protective against apoptosis, and this regulation is independent of MKP-1.
21817106 oxidized LDL also increased phosphorylation of protein kinase C beta(2) (PKCbeta(2)) at both Thr641 and Ser660, as well as c-Jun N-terminal kinase
21775054 Data indicate that co-administration perifosine with paclitaxel in ovarian cancer cells led to the inhibition of AKT, and a striking increase in the activation of pro-apoptosis pathways, including caspase 3, JNK1 and AMPKalpha1.
21768777 Data indicate that the induction of apoptosis was attributed to vinblastine-mediated activation of JNK.
21764057 Oxidized low density lipoprotein induces cyclin A synthesis in a process involving ERK, JNK and NFkappaB
21757743 Gq protein-induced apoptosis is mediated by AKT kinase inhibition that leads to protein kinase C-induced c-Jun N-terminal kinase activation
21752354 Data show that Fas-mediate events are mediated by ERK/JNK MAPKs which subsequently activate NF-kappaB for the transcriptional activation of pro-inflammatory mediators.
21729547 Bortezomib can decrease the expressions of protein ERK and P38 and enhance the expression of JNK in daunorubicin-resistant K562 cells.
21719561 in serum- or IGF-1-stimulated breast cancer MCF-7 cells, JNK induces SHP1 expression through the binding of AP-4 and RFX-1 transcription factors to the epithelial tissue-specific SHP1 promoter.
21697181 High C-Jun N-terminal kinase activity is associated with the survival of vestibular schwannoma cells by suppression of accumulation of mitochondrial superoxides
21660049 following stress-induced phosphorylation of Thr in the Thr-Pro motif of JNK1, JNK1 associates with Pin1 and undergoes conformational changes to promote the binding of JNK1 to its substrates, resulting in cellular responses from extracellular signals.
21651489 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
21629969 Data show that siRNA knockdown and SP600125 inhibition of JNK attenuated nuclear factor (NF)-kappaB activity and VCAM-1 expression.
21526344 phosphorylated JNK1 was higher in apocrine samples from axillary osmidrosis subjects
21524306 maslinic acid induces apoptosis in human HT29 colon-cancer cells through the JNK-Bid-mediated mitochondrial apoptotic pathway via the activation of p53.
21511059 kob A inhibited SNP-induced phosphorylation of JNK and c-Jun, and SNP-induced reduction in NF-kappaBeta and AP-1 activities.
21504622 Data indicate that isochaihulactone induces G2/M cell cycle arrest via downregulation of cyclin B1 and cdc2, and induces cellular death by upregulation of NAG-1 via JNK activation in LNCaP cells.
21483669 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
21483469 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
21465527 MEF is involved in PTH suppression of osteoblasts through activating the MKK4/JNK1 pathway and subsequently up-regulating Mab21l1 expression.
21454558 sequence of events exist for JNK mitochondrial signaling whereby ROS activates JNK, thereby affecting mitochondrial physiology, which can have effects on cell survival and death.
21439937 nuclear accumulation of JNK is regulated by interaction with c-Jun.
21384452 Data suggest that competition between GSTpi and active JNK for the substrate ATF2 may be responsible for the inhibition of JNK catalysis by GSTpi.
21378396 iron chelators significantly reduced ASK1-thioredoxin complex formation, resulting in the increased phosphorylation of ASK1, which activates the JNK and p38 pathways
21368226 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
21364637 JNK1 and JNK2 were identified as robust YAP kinases.
21364631 The results provide evidence that the JNK/c-Jun/AP-1 pathway plays a key role for T-cell death regulation in response to gal-1 stimulation.
21362231 Hyperactivation of JNK enhances proliferation of Daudi and Raji cells.
21237154 Data suggest that caspase 3-mediated cleavage of JIP1 scaffold proteins may represent an important mechanism for modulation of JNK signalling during apoptotic cell death.
21223552 Data show that PE5 increases the number of cells in S and G2/M cell cycle phases, which is accompanied by the increased expression of cyclin E and p21WAF1/CIP1 together with the underphosphorylation of p46 forms of JNK.
21212517 This study showed that the proline-rich doman of FGD1 is critical for persistent cell migration; FGD1 also augments EGF-stimulated c-Jun NH(2)-terminal kinase (JNK) activation.
21191018 These experiments suggest that JNK is required for lentivirus entry into target cells and may have implications for gene transfer or for development of antiviral agents.
21187925 p38 MAPK and JNK antagonistically control senescence and cytoplasmic p16INK4A expression in doxorubicin-treated endothelial progenitor cells
21172429 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
21172010 Perifosine induces DR5 expression through a JNK-dependent mechanism independent of reactive oxygen species.
21152872 The upstream molecule of the TRAIL-induced MAPK activation is MEKK, as opposed to ASK1, via the mediation of its signal through JNK/p38 in a caspase-8-dependent manner.
21148313 PrxII is likely to be attributed to a tumor survival factor positively regulating JNK-dependent DNA repair with its inhibition possibly sensitizing cancer cells to chemotherapeutic agents.
21148294 MKK7 works as a cytoplasmic anchoring protein for JNK1 in various cells, but exhibits aberrant nuclear entry in Jurkat cells; work suggests aberrant subcellular organization of JNK pathway may render certain tumor cells resistant to Fas-mediated apoptosis
21145111 Human periodontal ligament fibroblasts are a target of Th17, and that IL-17 appears to up-regulate the expression of IL-23 p19 via a homeostatic mechanism involving Akt-, p38 MAPK-, and ERK 1/2-dependent NF-kappaB signalling versus the JNK/AP-1 pathway.
21134350 results indicate involvement of the JNK/c-jun pathway in AR-mediated upregulation of CYP27A1. The link to JNK signaling is interesting since inflammatory processes may upregulate CYP27A1 to clear cholesterol from peripheral tissues.
21123173 Ser-707 is phosphorylated by c-Jun N-terminal kinase (JNK). Phosphorylation decreases the DNA binding ability of IL-4-stimulated STAT6, thereby inhibiting the transcription of STAT6-responsive genes
21122381 JNK1, Raf-1 and Livin may be involved in the carcinogenesis of sporadic colorectal tubular adenoma.
21106355 JNK might be an important downstream target of PKCalpha in multidrug resistance in breast cancer
20960177 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
20944115 JNK1 promotes cell survival in Her2/neu-positive breast cancer.
20919940 These findings indicate that OSS induces mtO2*- production via NADPH oxidase and JNK activation relevant for vascular oxidative stress.
20878914 In rheumatoid arthritis, the DNA-PKcs-JNK-Bim/Bmf axis transmits genotoxic stress into shortened survival of naive resting T cells, imposing chronic proliferative turnover of the immune system and premature immunosenescence.
20870032 Chlamydia pneumoniae infections disturb cholesterol homeostasis in human THP-1 macrophages and Chlamydia pneumoniae infection disturbs cholesterol homeostasis via JNK-PPARgamma dependent signal transduction pathways.
20829350 Data illustrate the importance of a coordinated signaling between Src PTKs, ERK1/2, and JNK during pIgR-mediated uptake of pneumococci by host epithelial cells.
20735357 JNK/SAPK and ERK1/2 signals therefore play critical roles in EGF-mediated HUVEC cell angiogenesis.
20717968 *ata demonstrate that PGE(2) partially stimulates hMSCs migration and proliferation by interaction of Pfn-1 and F-actin via EP2 receptor-dependent beta-arrestin-1/JNK signaling pathways.
20680486 TrkA shares a functional connection with other mediators in the DNA damage response via JNK signaling.
20648623 Data show that H(2)O(2)-dependent control of senescence-associated matrix metalloproteinase-1 is attributed to sustained JNK activation and c-jun recruitment to the MMP-1 promoter.
20647313 palmitate-induced ROS generation and that NOX3-derived ROS may drive palmitate-induced hepatic insulin resistance through JNK and p38(MAPK) pathways.
20632440 Data show that 8-bromo-7-methoxychrysin induces apoptosis of hepatocellular carcinoma cells by reactive oxygen species generation and sustained c-Jun N-terminal kinase activation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20622336 Inhibiting JNK decreased the apoptosis rate induced by intermittent high glucose.
20581839 Data report that a nuclear-localized portion of the stress-activated kinase JNK is degraded by the APC/C(Cdh1) during exit from mitosis and the G1 phase of the cell cycle.
20573157 Activation of the c-Jun N-terminal kinase pathway and macrophage migration inhibitory factor results in high glucopse-induced myocardial cell apoptosis.
20566643 PKCepsilon RNAi depletion significantly enhanced the release of TNFalpha in response to PMA and greatly potentiated JNK activation by this cytokine
20551953 DUSP16 is a new epigenetically regulated determinant of JNK activation in BL.
20525557 JNK1, JNK2, and JNK3 are involved in P-glycoprotein-mediated multidrug resistance of hepatocellular carcinoma cells.
20512919 These results strongly indicate ST13 mediated by adenovirus triggers colorectal cell apoptosis via ASK1-JNK signaling cascade
20511226 both NF-kappaB and SAPK activation appear independent of both TNFR1 localization to low density membrane domains and to TNF-induced receptor internalization
20495362 Cancer cell lines in which ILK functioned as a growth suppressor displayed elevated JNK1 expression relative to cells in which ILK functioned as an oncogene.
20490718 JNK1 plays an important role in lymphatic metastasis of hepatocellular carcinoma
20483734 Thymic stromal lymphopoietin induced proinflammatory gene expression in human airway smooth muscle cells involved ERK1/2, p38, and JNK, and STAT3 activation.
20483637 results indicate JNK1 negatively and JNK2 positively regulates IL-12 synthesis induced by LPS in THP-1 macrophages; PI3K p110beta affects JNK1 activity, but not JNK2 activity, as induced by LPS, resulting in positive regulation of IL-12 p40 production
20457808 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
20452983 PEA-15 promotes autophagy in glioma cells in a JNK-dependent manner
20450729 Prunella vulgaris shows a strong inhibitory effect upon the growth of lymphoma cell line Raji by activating the of JNK pathway and increasing Casp3 expression.
20432452 These results suggest that in human rheumatoid arthritis synovial fibroblasts, activation of ERK, JNK, AP-1, and NF-kappaB are essential for IL-1beta-induced ICAM-1 expression and leukocyte adhesion.
20380698 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
20371626 [review] molecular mechanisms by which JNK1 and IKKbeta mediate obesity-induced metabolic stress
20336759 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
20225236 This study demonstrated that IL-6 and high glucose synergistically stimulated MMP-1 expression in mononuclear phagocytes via ERK and JNK cascades and c-Jun upregulation.
20173753 phosphorylates HIV-1 integrase, which then becomes substrate for enzyme Pin1 as part of efficient HIV-1 integration into CD4+ cells
20173753 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
20156194 Filamin A is a scaffold protein whose function is to link MKK4 and MKK7 together and promote JNK1 activation.
20150185 Studies indicate that the MLK3/JNK1 axis mediates G17-induced gastric cancer cell migration, which can be targeted for designing novel therapeutic strategies for treating gastric malignancies.
20145041 The role of JNK changes when its activity is elevated above the basal levels associated with cell apoptosis; JNK activation serves as a marker of breast cancer progression and resistance to cytotoxic drugs.
20142324 JNK/Smad3 pathway plays a critical role in TGF-beta1-induced FXII expression in human lung fibroblasts
20139358 OxLDL-induced JNK activation regulates mitochondrial redox status and Mn-SOD protein degradation via JNK-dependent ubiquitination, leading to endothelial cell apoptosis.
20138424 Activation of p-JNK may play a role in the carcinogenesis and lymph node metastasis of papillary thyroid carcinoma.
20130137 These results reveal that, during influenza A virus infection, the PI3K/Akt pathway negatively regulates the JNK pathway via ASK1, thereby inhibiting JNK-dependent, Bax-mediated apoptosis.
20116378 JNK-ATF-2 inhibits thrombomodulin (TM) expression by recruiting histone deacetylase4 (HDAC4) and forming a transcriptional repression complex in the TM promoter.
20103647 Results show taht RSV triggered autophagic cell death in CML cells via both JNK-mediated p62 overexpression and AMPK activation.
20088952 These results imply that binding capacity of influenza A virus NS1 to CRK/CRKL has evolved in virus strains that over-induce the antiviral acting JNK-ATF2 signalling module and helps to suppress the detrimental apoptosis promoting action of this pathway.
20086174 Data show T117/T384 as Akt phosphorylation sites in MST2, and mutation of these sites inhibited MST2 binding to Raf-1 but enhanced binding to RASSF1A, accentuating downstream c-jun N-Terminal Kinase and p38 MAPK signaling and promoting apoptosis.
20074375 GnRH I and II could up-regulate MMP-26 expression through the JNK signaling pathway in human trophoblast-like/trophoblast cells.
20070945 excessive TRPM7 channel activity causes oxidative and nitrosative stresses, producing cell rounding mediated by p38 MAPK/JNK-dependent activation of m-calpain
20070836 Effects of UVA on TNF-alpha, IL-1beta, and IL-10 expression levels in human keratinocytes and intervention studies with an antioxidant and a JNK inhibitor.
20069553 These results suggest that in human tracheal smooth muscle cells, activation of MAPKs, NF-kappaB, and p300 are essential for IL-1beta-induced cPLA(2) expression and PGE(2) secretion.
20060003 CREG plays a key role in modulating VSMC apoptosis through the p38 and JNK signal transduction pathways, both in vitro and in s
20056910 Spatial variation of JNK1 activity delineates the spatial distribution of apoptosis and turnover of endothelial cells in arteries.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20051532 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
20027304 A functional interaction between cJUN N-terminal kinase (JNK1) and SIRT1 was identified by coimmunoprecipitation of endogenous proteins.
20018857 Restoration of efficient cell migration during cyclic stretch required coexpression of constitutively active PI3K, focal adhesion kinase, and JIP3.
19996270 Data show that small interfering RNA against JNK1, but not JNK2, exhibited similar effects to JNK inhibitors that reduced the protein levels of c-Myc and Bcl-2.
19995557 These results suggest that JNK contributes to RhoB induction, affecting the cell death response to gamma-radiation.
19966288 Data suggest that the posttranslational modifications and turnover of p45/NF-E2, as mediated by P-JNK, contribute to the control of its homeostatic concentration and consequently, its regulatory functions.
19940360 Study shows an essential role for apoptosis signal-regulating kinase 1 (ASK1), together with both c-jun-N-terminal kinase (JNK) and p38 pathways, and caspase-8 in Fas-induced apoptosis.
19940138 Data show that DNAzymes targeting c-Jun attenuated intimal hyperplasia in saphenous vein explants.
19937141 involved in glucose oxidase-mediated cell death of lymphoma cells
19923798 JNK/ATF2 pathway is involved in iodinated contrast media-induced apoptosis
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910486 JNK and WDR62 may regulate the dynamic interplay between polysomes stress granule and processing bodies, thereby mediating mRNA fate after stress.
19901160 Results suggest that MAPKs are sensors of pressure overload and that extracellular signal-regulated kinase activation in WBCs might be used as a novel surrogate biomarker of uncontrolled hypertension.
19900593 c-Jun N-terminal kinase (JNK) signaling: recent advances and challenges.
19893453 Data show that the activities of EGFR-MAPK signal pathway were inhibited significantly by overexpression of cav1.
19877043 Deficient Gadd45beta expression in RA can contribute to activation of JNK, exacerbate clinical arthritis, and augment joint destruction.
19864026 Complement C5b-9 induce a JNK/Bid-dependent and JNK-independent necrotic cell death.
19862774 Data revealed that DV infection enhances DC migration by inducing CCR7 expression, and that blocking COX-2 or MAPK activity suppresses DV-induced DC migration.
19859790 C-Jun-NH2 terminal kinase (JNK)-mediates AP-1 activation by thioredoxin.
19822666 Data suggest thta MST kinases 1/2 serve to monitor cytoskeletal integrity and couple the JNK1/SAPK1 pathway to the regulation of the cell cycle regulatory protein p21Waf1.
19822148 ERK(1/2) and JNK are involved in cigarette smoking-induced biphasic HO-1 expression by a specific regulation of Nrf2/Keap1-Bach1.
19815509 transcription factor Myc-interacting zinc-finger protein 1 (Miz1) selectively suppresses TNF-alpha-induced JNK1 activation and cell death independently.
19806201 JNK2 suppression of a novel JNK1/c-Jun/Bcl-3 apoptotic network hasa role in basal cancer cell survival
19803394 It plays an important role in cell differentiation of osteoblasts. (review)
19802005 Data show that that Frat synergizes with Diversin in the activation of JNK/AP-1 signaling.
19801633 Data show that B[a]PDE increases cyclin D1 expression, and activate the PI3-kinase/Akt/MAPK- and p70s6k pathway in Beas-2B bronchial epithelial cells.
19782079 JNK is involved in hepatic stellate cell activation and fibrogenesis
19778898 JNK and ceramide kinase govern the biogenesis of lipid droplets through activation of group IVA phospholipase A2
19748889 Inhibition of apoptosis by GIP is mediated via a key pathway involving Akt-dependent inhibition of apoptosis signal-regulating kinase 1, which subsequently prevents the pro-apoptotic actions of p38 MAPK and JNK.
19723627 Androgen via p21 inhibits tumor necrosis factor alpha-induced JNK activation and apoptosis
19723092 Data show that phloretin inhibits cell proliferation via the induction of apoptosis through the activation of p53, JNK and p38 mitogen-activated protein kinase signaling.
19695707 CRTAM expression is driven by the JNK-AP-1 signaling pathway.
19693773 JNK activation is involved in the terbinafine-induced inhibition of ERK phosphorylation, p53 and p21 up-regulation and DNA synthesis inhibition in HUVEC
19690982 The results suggest that livin may exert anti-apoptotic action on SPC-A1 by activating JNK1 signaling pathway and inhibiting caspase-3 activation.
19686584 Reported Hepatocellular carcinoma (HCC) signature genes based on the JNK1 activation status in 31 HCC specimens relative to the matched distal noncancerous liver tissue from 31 patients. The HCCs with high JNK1 and low JNK1 were sub-grouped.
19676104 Data show that BME induces the activation of c-Jun N-terminal kinases, p38 mitogen-activated protein kinases and extracellular signal-regulated kinases (ERK)1/2.
19667122 We propose that JNK binds to beta-catenin and regulates formation of adherens junctions, ultimately controlling cell-to-cell adhesion
19664626 Results suggest that JNK signaling is involved in the FGF2-induced stimulation of the proliferation and the maintenance of differentiation potential in human mesenchymal stem cells.
19638579 Importance of a novel JNK/p38-Cdc25B axis for a nongenotoxic stress-induced cell cycle checkpoint.
19620725 The JNKs differentially regulate RNA polymerase III transcription by coordinately modulating the expression of all TFIIIB subunits.
19616043 adrenomedullin is expressed in ovarian epithelial carcinoma tissue and bFGF can induce the expression of AM through the JNK-AP-1 pathway in ovarian epithelial carcinoma cell line CAOV(3)
19604147 Our results reveal that H2O2-induced MST3-mediated cell death involves suppressing both a JNK survival pathway and up-regulation of HO-1.
19596001 Data demonstrate that hypothermia represses ischemia/reperfusion-induced endothelial cell apoptosis by inhibiting both extrinsic- and intrinsic-dependent apoptotic pathways and activation of JNK1/2.
19589256 This study was designed to investigate the effect of c-Jun N-terminal kinase (JNK) 1 and 2 on TGF-beta(1)-regulated CTGF gene expression and corneal scar formation.
19574423 Cyclic mechanical strain impairs signaling of cell migration after injury via a pathway that involves FAK-JIP3-JNK.
19570911 Data show that Cys250 is essential for H(2)O(2)-dependent JNK signaling downstream from ASK1 but at a step subsequent to the phosphorylation of ASK1 Thr838.
19567513 Activation of JNK1/2 appears to be involved in serine phosphorylation of IRS1 and subsequently insulin resistance on glucose uptake, a state that can be reversed by liver X receptor agonists.
19523467 Data show that PKCeta is an anti-apoptotic protein, acting as a negative regulator of JNK activity.
19479051 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
19478459 restoration of JNK1 in alveolar rhabdomyosarcoma reestablished a tumor-suppressive function for integrin-linked kinase
19468799 LDM suppresses MM cell growth through the activation of p38 MAPK and JNK, with the potential to be developed as a chemotherapeutic agent for MM.
19454725 JNK plays an important role in the induction of apoptosis in human microvessel endothelial cells stimulated by LPS.
19424800 Expression and activity of JNK and PKCdelta in endometrial cancer cells modulate apoptosis.
19418584 Data show that in the liver of alveolar echinococcosis patients, ERK 1/2 and p38 MAPK were activated and PCNA expression was increased, and that upon exposure to vesicle fluid, c-Jun N-terminal kinase (JNK) was also activated in hepatocytes in vitro.
19352384 JNK1, but not JNK2 is activated by recombinant human TRAIL in colon cancer cell lines, which modulates apoptosis in these cells.
19351724 An Ask1-MKK4-p38MAPK/JNK pathway reflects adipocyte stress associated with adipose tissue inflammation, linking visceral adiposity to whole-body insulin resistance in obesity.
19339050 Knock-down of JNK1 increaes the intensity of 1,25-Dihydroxyvitamin D3-induced differentiation of human myeloid leukemia cells.
19319745 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
19287189 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
19286999 ALK signaling leads to the functional inactivation and/or degradation of p53 in JNK and MDM2 dependent manners.
19275580 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
19248119 IL-32 may be a newly identified prognostic biomarker in rheumatoid arthritis. Production of IL-32 in rheumatoid synovial fibroblasts is regulated by Syk/PKCdelta/JNK-mediated signaling events.
19206162 Data suggest that mechanical signals are transmitted into the nucleus by ERK/JNK signaling pathways and then stimulate collagen type I expression through AP-1 activation in force-exposed human periodontal ligament fibroblasts.
19194824 Thymosin beta-10 is aberrantly expressed in pancreatic cancer and induces JNK activation.
19168796 JNK pathway (p = 6.10(-6)) as a key event in response to high linear energy transfer ionizing radiation induced apoptosis in a non-small cell lung cancer cell line.
19166930 Silencing JNK expression reversed the phosphorylation of c-Jun induced by adrenomedullin. JNK is responsible for c-Jun activation. Activation of cJun/JNK pathway is involved in the growth regulatory activity of adrenomedullin in glioblastoma cells.
19159663 Results presented herein show for the first time direct interaction between JNK and GSTpi in SH-SY5Y neuroblastoma cells, and suggest that in these cells GSTpi may serve as a regulator of JNK catalytic activity.
19154785 important role in oxidative stress response caused by ultrafine particles from diesel vehicle engines
19097143 These results demonstrated that in A549 cells, activation of p50/p65 heterodimer through sequential activation of PKC alpha-JNK-NIK-IKK beta-NF-kappaB was required for IL-1 beta-induced uPA expression associated with migration of tumor cells.
19074436 the presence of melittin, TRAIL-induced apoptosis is significantly increased in TRAIL-resistant HCC cells, which may be attributed to melittin-induced TAK1-JNK/p38 activation and melittin-mediated inhibition of IkappaBalpha kinase-NFkappaB.
19071215 In mammary epithelial cells, up-regulation of SEPT9_v1 stabilizes JNK by delaying its degradation, thereby activating the JNK transcriptome.
19069644 Thermotherapy in combination with chemotherapy showed a stronger inhibitory effect than thermotherapy or chemotherapy alone on lung tumor cell growth by activation of c-Jun N-terminal kinase and inhibition of heat shock protein70.
19060920 activation of JNK pathway can mediate Beclin 1 expression, which plays a key role in autophagic cell death in cancer cells
19056926 JNK1 stimulated and mediated the effects of IFN and TNF-alpha on XAF1 expression through transcriptional regulation by induction of IRF-1.
19052872 c-Abl and p53 are important for execution of the cell death program initiated in A2E-laden RPE cells exposed to blue light, while JNK might play an anti-apoptotic role
19041150 JNK1 plays important roles in the development of human HCC partially through the epigenetic mechanisms.
19037093 AMPK controls the molecular mechanism underlying the differential biological functions of JNK, providing a novel explanation for the antiapoptotic role of LKB1.
19036714 Upon UVB-induced stress in keratinocytes, ROCK1 was activated, bound to JIP-3, and activated the JNK pathway
19033664 a mechanistic link between JNK activity and liver cell proliferation via p21 and c-Myc and suggest JNK1 targeting can be considered as a new therapeutic approach for HCC treatment.
18996088 These results suggest that JNK, but not caspase 8, involves in Fas-mediated CH11-induced autophagy in HeLa cells, and this autophagy plays a protective role in CH11-induced cell death.
18989785 Results show that Docetaxel-induced apoptosis is mediated by induction of ER stress, through activation of JNK and downstream targets of JNK.
18982452 Data show that an increase in JNK activation in the presence of NFkappaB inhibition significantly increased the expression of IGFBP6.
18979912 The changes of phospho-JNK expression after skin burned might correlate with wound healing.
18978303 dynasore may stimulate PAI-1 protein expression and enhance TGF-beta(1) activity through activation of JNK-mediated signaling in human pleural mesothelial cells
18950845 Observational study of gene-disease association. (HuGE Navigator)
18936517 JNK may play an important role in posttranscriptional control of LDL receptor expression, thus constituting a novel mechanism to enhance plasma LDL clearance by liver cells.
18922473 These results indicate that TGF-beta activates JNK and p38 through a mechanism similar to that operating in the interleukin-1beta/Toll-like receptor pathway.
18845538 a novel function for Parkin in modulating the expression of Eg5 through the Hsp70-JNK-c-Jun signaling pathway.
18818208 analysis of JNK-mediated phosphorylation of paxillin in adhesion assembly and tension-induced cell death by the adenovirus death factor E4orf4
18815275 These results establish a novel function of filamin B as a molecular scaffold in the JNK signaling pathway for type I IFN-induced apoptosis.
18782768 pneumolysin selectively induced expression of MKP1 via a TLR4-dependent MyD88-TRAF6-ERK pathway, which inhibited the PAK4-JNK signaling pathway,leading to up-regulation of MUC5AC mucin production
18769111 A speculative model for understanding the interrelationship between autophagy and apoptosis regulated by JNK1-mediated Bcl-2 phosphorylation was proposed.
18757369 a link between RhoA, JNK, c-Jun, and MMP2 activity that is functionally involved in the reduction in osteosarcoma cell invasion by the statin. This suggests a novel strategy targeting RhoA-JNK-c-Jun signaling to reduce osteosarcoma cell tumorigenesis.
18723442 whether MAP kinase phosphatase (MKP)-1, a negative regulator of p38 and JNK, mediates the antiinflammatory effects of shear stress.
18718914 15d-PGJ(2) induces vascular endothelial cell apoptosis through the signaling of JNK and p38 MAPK-mediated p53 activation both in vitro and in vivo
18713996 JNK is differentially regulated by MKK4 and MKK7 depending on the stimulus.
18713649 These results suggest that phosphorylation of paxillin on Ser 178 by JNK is required for the association of paxillin with FAK, and subsequent tyrosine phosphorylation of paxillin.
18703151 These results demonstrate that ERKs and JNKs are responsible for the decrease of cyclin D1 and CDK4 expression levels in human embryonic lung fibroblasts induced by silica.
18682391 Histamine-induced Egr-1 expression is dependent on the activation of the H1 receptor, and rapidly and transiently activates PKCdelta, ERK1/2, p38 kinase, and JNK prior to Egr-1 induction.
18681908 SIRT1 confers protection against UVB- and H2O2-induced cell death via modulation of p53 and JNK in cultured skin keratinocytes
18667537 necrosis factor-alpha-elicited stimulation of gamma-secretase is mediated by c-Jun N-terminal kinase-dependent phosphorylation of presenilin and nicastrin
18663379 Shikonin-induced oxidative injury operates at a proximal point in apoptotic signaling cascades, and subsequently activates the stress-related JNK pathway, triggers mitochondrial dysfunction, cytochrome c release, and caspase activation.
18651223 These findings suggest JNK to have an important pro-apoptotic function following ultraviolet rays B irradiation in human melanocytes, by acting upstream of lysosomal membrane permeabilization and Bim phosphorylation.
18636174 A functional analysis of JNK1 and M-RIP with RNA interference reveals a critical role for this cascade in the invasive behavior of cancer cells.
18620777 WWOX induces apoptosis and inhibits human hepatocellular carcinoma cell growth through a mechanism enhanced by JNK inhibition.
18603327 Data show that M. bovis BCG-induced human beta-defensin mRNA expression in A549 cells is regulated at least in part through activation of signaling proteins of PKC, JNK and PI3K.
18594007 c-Jun NH2-terminal protein kinase activation caused by tubulin depolymerization and DNA damage has a crucial role in moscatilin-induced apoptosis in human colorectal cancer cells
18573678 Data show that pokeweed antiviral protein (PAP) does not inhibit protein translation, but induces the activation of c-Jun NH2-terminal kinase (JNK), which was specific to rRNA depurination.
18570871 JNK1 mediates starvation-induced Bcl-2 phosphorylation, Bcl-2 dissociation from Beclin 1, and autophagy activation
18547751 Nanosilver acts through ROS and JNK to induce apoptosis via the mitochondrial pathway.
18541008 JNK, and in particular the JNK1 isoform, support the growth of melanoma cells, by controlling either cell cycle progression or apoptosis depending on the cellular context.
18540881 Although JNK activation may be a primary inducing factor, further phosphorylation of tau is required for neuronal death and NFT formation in neurodegenerative diseases, including those characterized by tauopathy.
18524773 JNK1 is a critical transcriptional target of FoxM1 that contributes to FoxM1-regulated cell cycle progression, tumor cell migration, invasiveness, and anchorage-independent growth
18506470 JNK is involved in regulation of proinflammatory mediators of endometrium
18495129 inhibition of JNK and p38 activation interrupts CD40 induced endothelial cell activation and apoptosis
18457359 is the key enzyme mediating melanogenesis in B16F10 cell.
18439101 These findings suggest that JNK1 and JNK2 are involved in TNF-alpha-induced neutrophil apoptosis and GM-CSF-mediated antiapoptotic effect on neutrophils, respectively.
18429822 Study demonstrates that the serine/threonine kinase PKN1 plays a critical role in regulating constitutive IKK/JNK activity in unstimulated cells and report on the molecular mechanism.
18405916 These data demonstrate the role of Cx43 in the proliferation and migration of human saphenous vein smooth muscle cells and angiotensin II-induced Cx43 expression via mitogen-activated protein kinases (MAPK)-AP-1 signaling pathway.
18401423 Although STAT1 phosphorylation required JNK and p38MAPK activation, only JNK activation was essential for IRF1 promoter activation by Tie2-R849W.
18373696 Ionizing radiation utilizes c-Jun N-terminal kinase for amplification of mitochondrial apoptotic cell death in cervical cancer.
18356158 H. pylori mediates CagA-independent signaling that promotes cell motility through the beta1 integrin-JNK pathway
18348163 Data show that JNK modulates the effect of caspases and NF-kappaB in the TNF-alpha-induced down-regulation of Na+/K+ATPase in HepG2 cells.
18344085 The protein expression rates of p-JNK and P-glycoprotein in gastric cancer were significantly higher than those in normal gastric tissue.
18337589 Phosphorylation aids GR sumoylation and that cross talk of JNK and SUMO pathways fine tune GR transcriptional activity.
18325654 Oxidative stress-activated JNK signaling pathway is involved in METH-induced cell death.
18316603 c-Jun translocates B23 and ARF from the nucleolus after JNK activation by means of protein interactions
18316600 ERK and JNK MAPK/Elk-1/Egr-1 signal cascade is required for p53-independent transcriptional activation of p21(Waf1/Cip1) in response to curcumin in U-87MG human glioblastoma cells
18297686 These results identify JNK, and not NFkappaB, as a critical mediator of TNF-alpha repressory effect on connexin 43 gene expression.
18293403 Preventing the TAK1/JNK1 signaling cascade in astrocytes might provide a fruitful strategy for treating intractable neuropathic pain.
18292600 PP2A and AIP1 cooperatively induce activation of ASK1-JNK signaling and vascular endothelial cell apoptosis.
18288129 both constitutive and sIgM-induced phosphorylation of p38 and JNK is inhibited by LAIR-1 through an ITIM-dependent signal
18286207 the activity of JIP1-JNK complexes is downregulated by VRK2 in response to interleukin-1beta
18276794 Glutamate cysteine ligase iz induced by hydroxynonenal through the c-Jun N-terminal kinase (JNK) pathway in respiratory epithelium.
18256527 Study shows that basal c-Jun N-terminal kinases (JNKs) are required for mitotic histone H3-S10 phosphorylation in human primary fibroblast IMR90 cells
18253836 activator protein-1 (AP-1) was activated through phosphorylation of cJun and cFos, induced by JNK and p38, respectively.
18249102 Our results suggest that clivorine has direct toxicity on HEK293 cells, and phosphorylated JNK may play some role in counteracting the toxicity of clivorine on HEK293 cells.
18219313 These results identify NLRX1 as a NLR that contributes to the link between reactive oxygen species generation at the mitochondria and innate immune responses.
18218857 corneal inflammation is significantly impaired in JNK1 knockout mice compared with control mice, and in mice treated with the JNK inhibitor compared with vehicle control.
18212053 c-Jun amino-terminal kinase (JNK) was important for neurite outgrowth stimulated by both Wnt-3a and Dkk1.
18199680 JNK1 activation is necessary to phosphorylate Sp1 and to shield Sp1 from the ubiquitin-dependent degradation pathway during mitosis in tumor cell lines.
18181766 ERK and JNK are involved in PMA-mediated MD-2 gene expression during HL-60 cell differentiation.
18164704 Our data first suggest that JNK participates in bFGF-mediated surface cadherin downregulation. Loss of surface cadherins may affect the cell-cell interaction between endothelial cells and facilitate angiogenesis.
18160848 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
18094581 The majority of acute myeloid leukemia cases did not show any levels of Mitogen-Activated Protein Kinases activation except for two cases, which were associated with an extremely high white blood cell count, chromosomal aberration.
18087676 These results clearly indicate that CCDC134 is a novel member of the secretory family and down-regulates the Raf-1/MEK/ERK and JNK/ SAPK pathways.
18086557 Activation of protease-activated receptors but not stimulation with lipopolysaccharides leads to ERK1/2 and JNK-mediated production of IL-8.
18082745 Nonalcoholic steatohepatitis is specifically associated with (1) failure to generate sXBP-1 protein and (2) activation of JNK.
18055217 We conclude that endogenous SOCS3 inhibits AP-1 activity through blocking of JNK phosphorylation.
18036196 The G/G genotype of MAPK8 SNP-1066 did not affect T2DM susceptibility despite specific binding of AP2alpha.
18036196 Observational study of gene-disease association. (HuGE Navigator)
18025271 Cyclin G2 expression is modulated by HER2 signaling through multiple pathways including phosphoinositide 3-kinase, c-jun NH(2)-terminal kinase, and mTOR signaling.
17982228 crude extract of D. farinae induces ICAM-1 expression in EoL-1 cells through signaling pathways involving both NF-kappaB and JNK
17967471 Critical role in cell transformation induced by EBV LMP1.
17942603 IFNalpha-induced apoptosis requires activation of ERK1/2, PKCdelta, and JNK downstream of PI3K and mTOR, and it can occur in a nucleus-independent manner, thus demonstrating that IFNalpha induces apoptosis in the absence of de novo transcription.
17933493 The induction of IFIT4 transcription by IFN-alpha depends upon sequential activation of PKCdelta, JNK and STAT1, and the influence of PKCdelta or JNK on IFN-alpha-mediated induction of IFIT4 is dependent upon the phosphorylation of STAT1 at Ser-727.
17913539 These results collectively indicated that Chlamydophilal antigens induce foam cell formation mainly via Toll-like receptor 2 and c-Jun NH2 terminal kinase.
17908987 JNK1/2 activity is commonly increased in head and neck squamous cell carcinoma
17904874 Our data show that basic JNK activity plays an important role in the progression of the cell cycle at G2/M cell phase.
17883418 Streptococcus intermedius histon-like DNA binding protein (Si-HLP) stimulation induced the activation of cell signal transduction pathways, extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK).
17785464 Study provides evidence during rolling and adhesion of platelets to vWF that platelet GPIb-vWF interaction triggers alphaIIbbeta3 activation in a JNK1-dependent manner; this was confirmed with a Glanzmann thrombastenic patient lacking alphaIIbbeta3.
17719653 Costimulation by anti-CD3 and anti-CD28 antibodies could activate JNK, p38 MAPK and NF-kappaB. The upregulation of IL-25 receptors were differentially regulated by intracellular JNK, p38 MAPK and NF-kappaB.
17704768 Results demonstrate that Fbl10 is a key regulator of c-Jun function.
17703233 findings establish a major role for DAPk and its specific interaction with PKD in regulating the JNK signaling network under oxidative stress.
17702750 long duration KOR antagonists disrupt KOR signaling by activating JNK
17699782 Findings suggest that the JNK/PTEN and NF-kappaB/PTEN pathways play a critical role in normal intestinal homeostasis and colon carcinogenesis.
17693927 Studies suggest that the target of regulation by PP2A includes upstream kinases in the JNK MAPK pathway.
17690186 Data suggest that JNK activation and decreased expression of MKP-1 may play important roles in progression of urothelial carcinoma.
17652454 These results indicate that Ask1 oxidation is required at a step subsequent to activation for signaling downstream of Ask1 after H(2)O(2) treatment.
17640761 This study reveals a novel pathway of gene regulation by alcohol which involves the activation of JNK and the consequent mRNA stabilization.
17626013 JNK and p38 mitogen-activated protein kinases were activated by TAK1.
17620321 These results support a significant role for ALK1 as a negative regulator of endothelial cell migration and suggest the implication of JNK and ERK as mediators of this effect.
17603935 TNF-alpha induced reactive oxygen species formation is mediated by JNK1, which regulates ferritin degradation and thus the level of highly reactive iron.
17584736 GCK is required for JNK and, unexpectedly, p38 activation by three bacterial PAMPs, lipopolysaccharide, peptidoglycan, and flagellin
17568996 IGF-1R and PDGFR co-inhibition caused an increased cell death in two human glioma cell lines and induced the radiosensitization of the JNK1 expressing cell line.
17545598 Findings showed that TOPK positively modulated UVB-induced JNK1 activity and played a pivotal role in JNK1-mediated cell transformation induced by H-Ras.
17541429 Gemin5 functions as a scaffold protein for the ASK1-JNK1 signaling module and thereby potentiates ASK1-mediated signaling events.
17496921 In this review, the interplay between NF-kappa B and JNK1 provides a paradigm that shows how crosstalk between different signaling pathways decides the function of the cell signaling circuitry.
17481915 These results indicate that binding of the alpha3beta1 integrin results in a suppression in the activation of the IL-1 induced intracellular signaling pathway from JNK to AP-1.
17478078 Proinvasive activity of BMP7 through SMAD4/src-independent and ERK/Rac/JNK-dependent signaling pathways in colon cancer cells is reported.
17453826 The regulation of three major mitogen-activated protein kinases phosphorylation, ERKp44/p42, p38, and JNK, was determined. The influence of specific mitogen-activated protein kinase inhibitors on IL-1 beta protein levels during beta-endorphin stimulation.
17317777 Increased expression of stress-activated kinases and IKK and their phosphorylated forms in omental fat occurs in obesity.
17303384 These results suggest that in human tracheal smooth muscle cells, activation of p42/p44 MAPK, p38, and JNK pathways, at least in part, mediated through NF-kappaB, is essential for lipopolysaccharide-induced VCAM-1 gene expression.
17296730 Human Rev7 (hRev7)/MAD2B/MAD2L2 is an interaction partner for Elk-1 and hRev7 acts to promote Elk-1 phosphorylation by the c-Jun N-terminal protein kinase (JNK) MAP kinases.
17255354 Oxidative stress response regulates DKK1 expression through the JNK signaling cascade in multiple myeloma plasma cells.
17178870 JNK1 is activated in response to collagen I, which increases tumorigenesis by up-regulating N-cadherin expression and by increasing motility.
17158878 PSK1-alpha is a bifunctional kinase that associates with microtubules, and JNK- and caspase-mediated removal of its C-terminal microtubule-binding domain permits nuclear translocation of the N-terminal region of PSK1-alpha and its induction of apoptosis
17079291 Overall, these results demonstrate the importance of the JNK pathway for varicella-zoster virus replication.
17074809 JNK1 and JNK2 differentially regulate TBP through Elk-1, controlling c-Jun expression and cell proliferation
17054907 Collectively, our results suggest that the inhibition of the interaction between JNK and c-Jun may be an integral part of the mechanism underlying the negative regulation of the JNK signaling pathway by NO.
17008315 STAT3 activation by G alpha(s) distinctively requires protein kinase A, JNK, and phosphatidylinositol 3-kinase
16983342 active JNK1 inhibits ubiquitination of C/EBPalpha possibly by phosphorylating in its DBD
16972261 Data show that pharmacologic inhibitors of extracellular signal-regulated kinase (ERKs) and c-Jun NH(2)-terminal kinase (JNK) decrease glutathione content and sensitize human promonocytic leukemia cells to arsenic trioxide-induced apoptosis.
16927023 This study is the first to demonstrate that H2O2 induces a Rac1/JNK1/p38 signaling cascade, and that JNK and p38 activation is important for H2O2-induced apoptosis as well as apoptosis-inducing factor/Bax translocation of retinal pigment epithelial cells.
16912864 Leptin stimulates proliferation and inhibits apoptosis in colon cancer cells. This effect involves JAK2, PI3 kinase and JNK and activation of the oncogenic transcription factors signal transducer and activator of transcription
16895791 TNF-alpha down-regulates human Cu/Zn superoxide dismutase 1 promoter via JNK/AP-1 signaling pathway
16824735 JNK1 is associated with UV signal transduction in human epidermis and SCCA1 is a suppressor of this process.
16815888 "PP1-JNK" pathway plays a role in H(2)O(2)-induced Sp1 phosphorylation in lung epithelial cells
16814421 Results show that activation of c-Jun N-terminal protein kinase, ERKs 1 and 2, and p38 MAP kinase is critical for Hs683 glioma cell migration induced by GDNF.
16802349 JNK (c-Jun N-terminal kinase) function might be modulated by targeting MKK-7 to suppress cytokine-mediated fibroblast-like synoviocytes (FLS) activation while leaving other stress responses intact.
16794185 Paclitaxel increases endothelial TF expression via its stabilizing effect on microtubules and selective activation of JNK
16760468 JNK is a critical component downstream of PI 3-kinase that may be involved in PDGF-stimulated chemotaxis presumably by modulating the integrity of focal adhesions by phosphorylating its components
16699726 ERK1/2, JNK1/2 and p38 mapk pathways are all required for B[a]P-induced G1/S transition
16687404 JNK-mediated feedback phosphorylation of MLK3 regulates its activation and deactivation states by cycling between Triton-soluble and Triton-insoluble forms
16648634 Inhibition of JNK in epidermal keratinocytes is sufficient to initiate their differentiation program and suggest that augmenting JNK activity could be used to delay cornification and enhance wound healing.
16569638 matrix metalloproteinase-1 expression is regulated by JNK through Ets and AP-1 promoter motifs
16539678 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
16481105 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
16465391 We investigated whether Jun-N-terminal kinase activation is increased in inflammatory bowel disease and analyzed the effects of SP600125, which decreases inflammatory cytokine synthesis by inhibiting the phosphorylation of this kinase.
16434970 Both activation of JNK and inhibition of Akt play a role in translocation of Nur77 from the nucleus to the cytoplasm.
16412424 Data report that cepharanthine induces apoptosis in HuH-7 cells through activation of JNK1/2 and the downregulation of Akt.
16407310 Prostate-derived sterile 20-like kinase 2 (PSK2) regulates apoptotic morphology via C-Jun N-terminal kinase and Rho kinase-1
16395283 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
16381010 results indicate that the aberrant p-JNK1/2 expression and the co-expressed p-JNK1/2 and p-p38 in breast tissues may play a role in the carcinogenesis of breast infiltrating ductal carcinoma
16339571 TNF-alpha induced PTX3 expression in human lung cell lines and primary epithelial cells; knockdown of either JNK1 or JNK2 with small interfering RNA also significantly reduced the regulated PTX3 expression
16328781 Results suggest that VEGF induced by hyperbaric oxygen is through c-Jun/AP-1 activation, and through simultaneous activation of ERK and JNK pathways.
16321971 in gastric epithelial cells, H. pylori up-regulates MMP-1 in a type IV secretion system-dependent manner via JNK and ERK1/2
16307741 gemcitabine-induced apoptosis in human non-small cell lung cancer H1299 cells requires activation of the JNK1 signaling pathway
16283431 Results describe the opposite effect of ERK1/2 and JNK on p53-independent p21WAF1/CIP1 activation involved in the arsenic trioxide-induced human epidermoid carcinoma A431 cellular cytotoxicity.
16282329 Foxo1 is involved in the nucleocytoplasmic translocation of PDX-1 by oxidative stress and the JNK pathway
16260609 c-Jun N-terminal kinase signaling is regulated by a stabilization-based feed-forward
16260419 protein kinase Cdelta and JNK have roles in Ifn-alpha induced expression of phospholipid scramblase 1 through STAT1
16243842 Vpr protein activates activator protein-1, c-Jun N-terminal kinase, and NF-kappaB and stimulates HIV-1 transcription in promonocytic cells and primary macrophages
16243842 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
16176806 The activation of JNK1 is required for the triptolide-induced inhibition of tumor proliferation.
16166642 JAMP is a membrane-anchored regulator of the duration of JNK1 activity in response to diverse stress stimuli
16105650 We concluded that JNK pathway might play an important role in mediating cisplatin-induced apoptosis in A2780 cells, and the duration of JNK activation might be critical in determining whether cells survive or undergo apoptosis.
16086581 results suggest that activated JNK can, in turn, activate not only jun but also raf that, in turn, activates MEK that can then cross-activate JNK in a positive feedback loop
15981086 rF1-induced JNK MAPK activity was correlated to the functional activation of macrophages by demonstrating the inhibition of NO, TNF-alpha production and microtubule polymerization
15890690 JNK may act via c-Myc and Egr-1, which were shown to be important for B-lymphoma survival and growth.
15860507 Some green tea catechins induce pro-MMP-7 production via O2- production and the activation of JNK1/2.
15827086 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
15778501 p53 participates in a feedback mechanism with JNK to regulate the apoptotic process and is oppositely regulated by JNK1 and JNK2.
15769735 raft-associated acid sphingomyelinase and JNK activation and translocation are induced by UV-C light on a nuclear signal
15755722 PKD is a critical mediator in H2O2- but not TNF-induced ASK1-JNK signaling
15696159 JNK phosphorylates 14-3-3 proteins, which regulate nuclear targeting of c-Abl in the apoptotic response to DNA damage
15665513 TNF-alpha causes a net up-regulation of MUC2 gene expression in cultured colon cancer cells because NF-kappaB transcriptional activation of this gene is able to counter-balance the suppressive effects of the JNK pathway
15657352 Alpha-tocopheryl sulfsatse showed increased levels in prostate tumor cells.
15655348 ERK1/2 and JNK1/2 signaling is stimulated by radiation and can promote cell cycle progression in human colon cancer cells
15637062 Caspase 3-cleaved SH3 domain of HIP-55 is likely involved in PRAM-1-mediated JNK activation upon arsenic trioxide-induced differentiation of NB4 cells.
15629131 While JNK1 is a downstream effector of the Tumor Necrosis Factor (TNF) signaling, Zfra regulation of the TNF cytotoxic function is likely due to its interaction, in part, with JNK1
15603708 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
15569856 The ACE-inhibitor mediated activation of the c-Jun N-terminal kinase (JNK)/c-Jun pathway, results in an enhanced endothelial ACE expression
15542843 activation of p38 MAPK and c-Jun N-terminal kinase pathways by hepatitis B virus X protein mediates apoptosis via induction of Fas/FasL and TNFR1/TNFa expression
15528994 Cooperation of CD99 engagement with suboptimal TCR/CD3 signals resulted in enhanced CD4+ T cell proliferation, elevated expression of CD25 and GM1, increased apoptosis, augmented activation of JNK, and increased AP-1 activation
15527495 crucial role of JNK signalling pathway in N. meningitidis invasion in human brain microvascular endothelial cells
15516492 Antiproliferative and prodifferentiation effects of BMP4 were Smad1 dependent with JNK also contributing to differentiation.
15474087 SAPKgamma/JNK1 and SAPKalpha/JNK2 may be important mediators of stress-induced responses in early implanting conceptuses that could mediate embryo loss.
15456887 Data show that endogenous germinal center kinase is activated by agonists that require TRAF6 for c-Jun N-terminal kinase activation.
15246824 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
15238629 The c-Jun-N-terminal kinase(JNK)cascade mediates the stimulatory effect Angiotensin II has on the proximal renin promoter in humans.
15013949 JNK signaling regulates the phosphorylation state of several kinases in skeletal muscle. JNK activation is unlikely to be the major mechanism by which contractile activity increases glycogen synthase activity in skeletal muscle.
14981905 Inducible expression of RbAp46 activated the c-Jun N-terminal kinase (JNK) signaling pathway and triggered apoptosis in Saos-2 cells xenografted into nude mice.
14766760 JNK regulates the expression of HIPK3 in prostate cancer cells, which leads to increased resistance to Fas receptor-mediated apoptosis by reducing the interaction between FADD and caspase-8
14729602 Calcium signaling in ovarian surface epithelial cells not only induces telomerase activity via JNK but also activates Pyk2.
14724588 activation of JNK is important for the induction of apoptosis following stresses that function at different cell cycle phases, and that basal JNK activity is necessary to promote proliferation and maintain diploidy in breast cancer cells
14701702 data support an essential role for JNK signaling in the induction of growth inhibition and apoptosis by As(2)O(3)
14699155 JNK activation is important for lipopolysacchairde-induced MCP-1 expression but not for TNF-alpha or IL-8 expression
14688370 Stress-activated protein kinase 1 is involved in the control of monocyte chemoattractant protein-1-induced migration of MonoMac6 cells.
14637155 Fas-induced cell death and JNK activation are sensitive to Fas stimulation in cell lines carrying undetectable level of c-FLIP(L).
14597672 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
14561739 JNK inhibition with SP600125 also blocked binding of Sp1 to the DR5/TRAIL-R2 promoter.
14557276 c-Jun N-terminal kinase activation in T cell receptor signaling is mediated by SH3 domain-containing adaptor HIP-55
14532003 Results show that tumor necrosis factor alpha-mediated caspase 8 cleavage and apoptosis require a sequential pathway involving c-Jun N-terminal kinase, Bid, and Smac/DIABLO.
14514687 late but not early JNK1 activation is associated with the induction of apoptosis
14500675 Findings strongly suggest that the JNK/AP-1 transcription factor signaling pathway has little or no impact on the generation of inflammatory mediators in neutrophils.
12960231 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
12917434 Threonine 668 within the Amyloid beta protein precursor intracellular domain is indeed phosphorylated by JNK1; although JIP-1 can facilitate this phosphorylation, it is not required for this process.
12902351 adipose cytokines and JNK are key mediators between obesity and hormone-resistant prostate cancer
12878610 Axin utilizes distinct regions for competitive MEKK1 and MEKK4 binding and JNK activation.
12859962 Data show that inhibition of arachidonate 5-lipoxygenase induces rapid activation of c-Jun N-terminal kinase (JNK) in human prostate cancer cells which is prevented by the 5-lipoxygenase metabolite, 5(S)-HETE.
12857973 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
12847227 c-Jun N-terminal kinase plays a negative role in the production of IL-12 from human macrophages stimulated by lipopolysaccharide.
12810082 Results suggest that tissue or plasma fibronectin may modulate the intestinal epithelial response to repetitive deformation through inhibted activation of p38 and jun kinases.
12775419 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
12714584 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
12707267 JNK1 has a role in the synergistic effect of TRAIL combined with DNA damage by mediating signals independent of p53 leading to apoptosis
12646240 Data suggest that epidermal growth factor (EGF) stimulated c-Jun N-terminal kinase phosphorylation of c-Jun is uncoupled from protein kinase D suppression in cancer cells.
12592382 Western blot demonstrated that phosphorylation of JNK was induced only by TPA during 30 min to 1 h.
12538493 JNK is required for growth of prostate carcinoma cells in vitro and in vivo
12514174 phosphorylation of JNK1 and WOX1 is necessary for their physical interaction and functional antagonism
12478662 JNK-1 and p38 play a role in apoptosis induced by capsaicin in H-ras-transformed tumor cells
12421945 JNK activation is predominantly involved in the induction of CD44 expression in monocytic cells via lipopolysaccharide-mediated signaling.
12413764 Psoriatic epidermis shows selective activation of ERK and JNK, which might be related to hyperproliferation and abnormal differentiation of psoriatic epidermis.
12359245 Relationship of Mcl-1 isoforms, ratio p21WAF1/cyclin A and this protein phosphorylation to apoptosis in human breast carcinomas.
12354774 JNK has isoform-selective gene regulation and distinct JNK isoforms have a role in specific cellular responses
12296995 TAK1-dependent activation of AP-1 and c-Jun N-terminal kinase by receptor activator of NF-kappaB.
12239168 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
12206715 description of the signaling of JNK and p38 MAPK in apoptosis after stimulation by antioxidants
12148599 Unimpaired activation of c-Jun NH2-terminal kinase (JNK) 1 upon CD40 stimulation in B cells of patients with X-linked agammaglobulinemia.
12143039 Jun kinase modulates tumor necrosis factor-dependent apoptosis in liver cells
12140754 Elevated JNK activation contributes to the pathogenesis of human brain tumors
12135322 Galpha13 can induce ppET-1 gene expression through a JNK-mediated pathway.
12089333 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
12079429 the NOx-induced cell proliferation via activation of JNK1 might contribute to lung tissue damage caused by NOx
12058028 role in stabilizing p21(Cip1) by phosphorylation
12058026 novel role for the I kappa B kinase complex-associated protein (IKAP) in the regulation of activation of the mammalian stress response via the c-Jun N-terminal kinase (JNK)-signaling pathway
12023963 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
11971973 These data strongly suggest that in TNF-induced apoptosis, Hsp72 specifically interferes with the Bid-dependent apoptotic pathway via inhibition of JNK.
11931768 Results show that the N-CoR-HDAC3 complex inhibits JNK activation through the associated GPS2 subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP-1 function.
11912216 Polycystin-1 activation of c-Jun N-terminal kinase and AP-1 is mediated by heterotrimeric G proteins
11698270 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
11504923 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
11468147 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
11448159 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
11260070 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
11153078 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
10799874 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
10509564 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
10394361 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
9670954 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
9621077 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
9403476 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
9223324 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
9129988 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells
9045910 HIV-1 Tat induces phosphorylation of MAPK8 (JNK) in CRT-MG human astroglioma cells

AA Sequence

MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRA      1 - 70
YRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIK     71 - 140
HLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWS    141 - 210
VGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLF    211 - 280
PADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIE    281 - 350
EWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA    351 - 420
GPLGCCR                                                                   421 - 427
//

Text Mined References (703)

PMID Year Title
26988982 2016 IL-17 mediates inflammatory reactions via p38/c-Fos and JNK/c-Jun activation in an AP-1-dependent manner in human nucleus pulposus cells.
26988444 2016 A conserved motif in JNK/p38-specific MAPK phosphatases as a determinant for JNK1 recognition and inactivation.
26928204 2016 Uni-axial stretch induces actin stress fiber reorganization and activates c-Jun NH2 terminal kinase via RhoA and Rho kinase in human bladder smooth muscle cells.
26838722 2016 The NADase-Negative Variant of the Streptococcus pyogenes Toxin NAD? Glycohydrolase Induces JNK1-Mediated Programmed Cellular Necrosis.
26792731 2016 cAMP signaling increases histone deacetylase 8 expression by inhibiting JNK-dependent degradation via autophagy and the proteasome system in H1299 lung cancer cells.
26718614 2016 Oxidized low-density lipoprotein upregulates microRNA-146a via JNK and NF-?B signaling.
26708719 2016 Combined Activities of JNK1 and JNK2 in Hepatocytes Protect Against Toxic Liver Injury.
26694167 2016 ASK1/JNK-mediated TAp63 activation controls the cell survival signal of baicalein-treated EBV-transformed B cells.
26668357 2015 Lymphomagenic CARD11/BCL10/MALT1 signaling drives malignant B-cell proliferation via cooperative NF-?B and JNK activation.
26667302 2016 Negative feedback regulation of AXL by miR-34a modulates apoptosis in lung cancer cells.
26648552 2016 c-Jun N-terminal kinase inhibitor favors transforming growth factor-? to antagonize hepatitis B virus X protein-induced cell growth promotion in hepatocellular carcinoma.
26575790 2016 Protein 4.1N acts as a potential tumor suppressor linking PP1 to JNK-c-Jun pathway regulation in NSCLC.
26573109 2016 Activation of Tax protein by c-Jun-N-terminal kinase is not dependent on the presence or absence of the early growth response-1 gene product.
26559961 2016 The c-Jun N-terminal kinase (JNK) is involved in H5N1 influenza A virus RNA and protein synthesis.
26546165 2016 Regulation of autophagy by Beclin 1 in the heart.
26519559 2015 JNK1 inhibits transcriptional and pro-apoptotic activity of TAp63?.
26503828 2015 Phloretin induces apoptosis of non-small cell lung carcinoma A549 cells via JNK1/2 and p38 MAPK pathways.
26429914 2015 Phosphorylation of Glutathione S-Transferase P1 (GSTP1) by Epidermal Growth Factor Receptor (EGFR) Promotes Formation of the GSTP1-c-Jun N-terminal kinase (JNK) Complex and Suppresses JNK Downstream Signaling and Apoptosis in Brain Tumor Cells.
26418950 2015 Apoptosis induced by temozolomide and nimustine in glioblastoma cells is supported by JNK/c-Jun-mediated induction of the BH3-only protein BIM.
26397194 2015 Isothiocyanates inhibit the invasion and migration of C6 glioma cells by blocking FAK/JNK-mediated MMP-9 expression.
26352010 2015 Leishmania mexicana amastigotes inhibit p38 and JNK and activate PI3K/AKT: role in the inhibition of apoptosis of dendritic cells.
26296767 2015 HCV upregulates Bim through the ROS/JNK signalling pathway, leading to Bax-mediated apoptosis.
26286024 2015 The transcription cofactor c-JUN mediates phenotype switching and BRAF inhibitor resistance in melanoma.
26258887 2015 PARP14 promotes the Warburg effect in hepatocellular carcinoma by inhibiting JNK1-dependent PKM2 phosphorylation and activation.
26235742 2015 JNK is required for maintaining the tumor-initiating cell-like properties of acquired chemoresistant human cancer cells.
26204503 2015 Hydrogen peroxide signals E. coli phagocytosis by human polymorphonuclear cells; up-stream and down-stream pathway.
26165348 2015 Autophagy attenuates the catabolic effect during inflammatory conditions in nucleus pulposus cells, as sustained by NF-?B and JNK inhibition.
26157010 2015 JNK-dependent gene regulatory circuitry governs mesenchymal fate.
26134032 2015 Effect of N-n-butyl haloperidol iodide on ROS/JNK/Egr-1 signaling in H9c2 cells after hypoxia/reoxygenation.
26095851 2015 Cyclophilin A regulates JNK/p38-MAPK signaling through its physical interaction with ASK1.
26058961 2016 MAPK8-mediated stabilization of SP1 is essential for RUNX1-RUNX1T1 - driven leukaemia.
26053095 2015 PP2A inhibitors arrest G2/M transition through JNK/Sp1- dependent down-regulation of CDK1 and autophagy-dependent up-regulation of p21.
25955534 2015 Gartanin induces autophagy through JNK activation which extenuates caspase-dependent apoptosis.
25896662 2015 2-Methoxy-1,4-naphthoquinone (MNQ) induces apoptosis of A549 lung adenocarcinoma cells via oxidation-triggered JNK and p38 MAPK signaling pathways.
25847947 2015 DUSP4 deficiency caused by promoter hypermethylation drives JNK signaling and tumor cell survival in diffuse large B cell lymphoma.
25792289 2015 Effect of Jun N-terminal kinase 1 and 2 on the replication of Penicillium marneffei in human macrophages.
25779847 2015 Angiotensin-(1-7) stimulates cholesterol efflux from angiotensin II-treated cholesterol-loaded THP-1 macrophages through the suppression of p38 and c-Jun N-terminal kinase signaling.
25737554 2015 Structure and dynamics of the MKK7-JNK signaling complex.
25726846 2015 High-mobility group box-1 induces vascular remodelling processes via c-Jun activation.
25583514 2015 Impaired Hippo signaling promotes Rho1-JNK-dependent growth.
25546243 2015 Inflammatory IL-1?-driven JNK activation in stage III melanoma.
25526895 2015 Mucin1 mediates autocrine transforming growth factor beta signaling through activating the c-Jun N-terminal kinase/activator protein 1 pathway in human hepatocellular carcinoma cells.
25504636 2015 Glycogen synthase kinase 3? sustains invasion of glioblastoma via the focal adhesion kinase, Rac1, and c-Jun N-terminal kinase-mediated pathway.
25502879 2014 Protoporphyrin IX induces a necrotic cell death in human THP-1 macrophages through activation of reactive oxygen species/c-Jun N-terminal protein kinase pathway and opening of mitochondrial permeability transition pore.
25501809 2015 Opposing roles for JNK and Aurora A in regulating the association of WDR62 with spindle microtubules.
25496033 2015 Farnesoid X receptor antagonizes JNK signaling pathway in liver carcinogenesis by activating SOD3.
25456131 2014 JNK suppresses tumor formation via a gene-expression program mediated by ATF2.
25423287 2015 The role of the c-Jun N-terminal kinases 1/2 and receptor-interacting protein kinase 3 in furosemide-induced liver injury.
25415535 2015 Inhibitors of c-Jun N-terminal kinases: an update.
25353341 2014 Phosphorylation of sterol regulatory element-binding protein (SREBP)-1c by p38 kinases, ERK and JNK influences lipid metabolism and the secretome of human liver cell line HepG2.
25341038 2014 JNK-NQO1 axis drives TAp73-mediated tumor suppression upon oxidative and proteasomal stress.
25316285 2014 Placenta-breast cancer cell interactions promote cancer cell epithelial mesenchymal transition via TGF?/JNK pathway.
25288801 2014 The lysosome rupture-activated TAK1-JNK pathway regulates NLRP3 inflammasome activation.
25284480 2014 Naturally occurring neomorphic PIK3R1 mutations activate the MAPK pathway, dictating therapeutic response to MAPK pathway inhibitors.
25270024 2014 CCR7 regulates cell migration and invasion through MAPKs in metastatic squamous cell carcinoma of head and neck.
25254627 2014 Glutamine deprivation stimulates mTOR-JNK-dependent chemokine secretion.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25233933 2014 OncomiR-196 promotes an invasive phenotype in oral cancer through the NME4-JNK-TIMP1-MMP signaling pathway.
25218495 2015 GRP78 promotes the invasion of pancreatic cancer cells by FAK and JNK.
25160932 2014 HIV-1 induces B-cell activation and class switch recombination via spleen tyrosine kinase and c-Jun N-terminal kinase pathways.
25116390 2014 Activation of PI3K/Akt pathway limits JNK-mediated apoptosis during EV71 infection.
25113506 2014 Urokinase-type plasminogen activator receptor regulates apoptotic sensitivity of colon cancer HCT116 cell line to TRAIL via JNK-p53 pathway.
25077544 2014 JNK1/2 regulate Bid by direct phosphorylation at Thr59 in response to ALDH1L1.
25068797 2014 Carbamoylating activity associated with the activation of the antitumor agent laromustine inhibits angiogenesis by inducing ASK1-dependent endothelial cell death.
25043814 2014 A macrophage NBR1-MEKK3 complex triggers JNK-mediated adipose tissue inflammation in obesity.
24984152 2014 Cleaved high molecular weight kininogen stimulates JNK/FOXO4/MnSOD pathway for induction of endothelial progenitor cell senescence.
24970676 2014 Connecting endoplasmic reticulum stress to autophagy through IRE1/JNK/beclin-1 in breast cancer cells.
24963148 2014 A positive feedback loop between RIP3 and JNK controls non-alcoholic steatohepatitis.
24947996 2014 Targeting the K-Ras--JNK axis eliminates cancer stem-like cells and prevents pancreatic tumor formation.
24936061 2014 A combined "omics" approach identifies N-Myc interactor as a novel cytokine-induced regulator of IRE1 protein and c-Jun N-terminal kinase in pancreatic beta cells.
24927726 2014 Ionizing radiation affects the expression of Toll-like receptors 2 and 4 in human monocytic cells through c-Jun N-terminal kinase activation.
24914133 2014 Hydroxyurea-inducible SAR1 gene acts through the Gi?/JNK/Jun pathway to regulate ?-globin expression.
24906853 2014 Activation of JNK1/2 and p38 MAPK signaling pathways promotes enterovirus 71 infection in immature dendritic cells.
24901053 2014 ?NAC inhibition of the FADD-JNK axis plays anti-apoptotic role in multiple cancer cells.
24825906 2014 EphrinB1 interacts with CNK1 and promotes cell migration through c-Jun N-terminal kinase (JNK) activation.
24820448 2014 Human cord blood stem cell paracrine factors activate the survival protein kinase Akt and inhibit death protein kinases JNK and p38 in injured cardiomyocytes.
24787013 2014 Reversion of apoptotic resistance of TP53-mutated Burkitt lymphoma B-cells to spindle poisons by exogenous activation of JNK and p38 MAP kinases.
24699410 2014 uPAR and cathepsin B-mediated compartmentalization of JNK regulates the migration of glioma-initiating cells.
24679696 2014 Determination of protein phosphatase type 2A in monocytes from multiple trauma patients: a potential biomarker for sepsis.
24661418 2014 JNK suppresses pulmonary fibroblast elastogenesis during alveolar development.
24642040 2014 Receptor-interacting protein kinase 2 promotes triple-negative breast cancer cell migration and invasion via activation of nuclear factor-kappaB and c-Jun N-terminal kinase pathways.
24589734 2014 Differences in c-Jun N-terminal kinase recognition and phosphorylation of closely related stathmin-family members.
24587347 2014 JNK contributes to the tumorigenic potential of human cholangiocarcinoma cells through the mTOR pathway regulated GRP78 induction.
24556843 2014 Activation of ?7 nicotinic acetylcholine receptor protects against oxidant stress damage through reducing vascular peroxidase-1 in a JNK signaling-dependent manner in endothelial cells.
24515990 2014 Hypoxic response contributes to altered gene expression and precapillary pulmonary hypertension in patients with sickle cell disease.
24515257 2014 Transforming growth factor-?1 downregulates vascular endothelial growth factor-D expression in human lung fibroblasts via the Jun NH2-terminal kinase signaling pathway.
24502975 2014 Convergent regulation of the lysosomal two-pore channel-2 by Mg²?, NAADP, PI(3,5)P? and multiple protein kinases.
24457963 2014 c-Jun N-terminal kinase has a key role in Alzheimer disease synaptic dysfunction in vivo.
24452601 2014 FOXO1-dependent DNA damage repair is regulated by JNK in lung cancer cells.
24434780 2014 JNK1 stress signaling is hyper-activated in high breast density and the tumor stroma: connecting fibrosis, inflammation, and stemness for cancer prevention.
24366007 2014 Nutlin-3 induces HO-1 expression by activating JNK in a transcription-independent manner of p53.
24335928 2014 Efficient keratinocyte differentiation strictly depends on JNK-induced soluble factors in fibroblasts.
24316756 2014 JNK contributes to temozolomide resistance of stem-like glioblastoma cells via regulation of MGMT expression.
24225136 2014 Alkylphosphocholines and curcumin induce programmed cell death in cutaneous T-cell lymphoma cell lines.
24184208 2014 Intracellular mobility and nuclear trafficking of the stress-activated kinase JNK1 are impeded by hyperosmotic stress.
24170769 2014 Sorafenib suppresses JNK-dependent apoptosis through inhibition of ZAK.
24127566 2013 Phosphorylation of moesin by Jun N-terminal kinase is important for podosome rosette formation in Src-transformed fibroblasts.
24091673 2013 Asymmetric dimethylarginine attenuates serum starvation-induced apoptosis via suppression of the Fas (APO-1/CD95)/JNK (SAPK) pathway.
24086554 2013 Febuxostat, an inhibitor of xanthine oxidase, suppresses lipopolysaccharide-induced MCP-1 production via MAPK phosphatase-1-mediated inactivation of JNK.
24073601 2014 Increased expression of c-Fos, c-Jun and c-Jun N-terminal kinase associated with neuronal cell death in retinas of diabetic patients.
24055030 2013 MUC1 activates JNK1 and inhibits apoptosis under genotoxic stress.
24040019 2013 Synergistic apoptosis of CML cells by buthionine sulfoximine and hydroxychavicol correlates with activation of AIF and GSH-ROS-JNK-ERK-iNOS pathway.
24037431 2014 Jnk1 in murine hepatic stellate cells is a crucial mediator of liver fibrogenesis.
24023291 2013 Enhanced redox factor 1 (REF1)-modulated p53 stabilization and JNK1 dissociation in response to selenomethionine.
24023255 2013 Ajuba family proteins link JNK to Hippo signaling.
24008433 2013 2-Aminophenoxazine-3-one-induced apoptosis via generation of reactive oxygen species followed by c-jun N-terminal kinase activation in the human glioblastoma cell line LN229.
23981301 2013 Combining docking site and phosphosite predictions to find new substrates: identification of smoothelin-like-2 (SMTNL2) as a c-Jun N-terminal kinase (JNK) substrate.
23922701 2013 Overexpressed DNA polymerase iota regulated by JNK/c-Jun contributes to hypermutagenesis in bladder cancer.
23916702 2013 Expression and proliferation profiles of PKC, JNK and p38MAPK in physiologically stretched human bladder smooth muscle cells.
23912840 2013 Specific role of JNK in the maintenance of the tumor-initiating capacity of A549 human non-small cell lung cancer cells.
23906792 2013 Connective tissue growth factor induces collagen I expression in human lung fibroblasts through the Rac1/MLK3/JNK/AP-1 pathway.
23900681 2013 In vivo and in vitro inhibition of human liver cancer progress by downregulation of the ?-opioid receptor and relevant mechanisms.
23900581 2013 Modulation of the response of prostate cancer cell lines to cisplatin treatment using small interfering RNA.
23891538 2014 IFN-?-induced IL-27 and IL-27p28 expression are differentially regulated through JNK MAPK and PI3K pathways independent of Jak/STAT in human monocytic cells.
23861391 2013 SH3-binding protein 5 mediates the neuroprotective effect of the secreted bioactive peptide humanin by inhibiting c-Jun NH2-terminal kinase.
23857473 2013 CAPE promotes TRAIL-induced apoptosis through the upregulation of TRAIL receptors via activation of p38 and suppression of JNK in SK-Hep1 hepatocellular carcinoma cells.
23817665 2013 ?-Elemene enhances susceptibility to cisplatin in resistant ovarian carcinoma cells via downregulation of ERCC-1 and XIAP and inactivation of JNK.
23776175 2013 SASH1 is a scaffold molecule in endothelial TLR4 signaling.
23770673 2013 The small GTPase RALA controls c-Jun N-terminal kinase-mediated FOXO activation by regulation of a JIP1 scaffold complex.
23715767 2013 Increased expression of p21Waf1/Cip1 and JNK with costimulation of prostate cancer cell activation by an siRNA Egr-1 inhibitor.
23712703 2013 The activation of HMGB1 as a progression factor on inflammation response in normal human bronchial epithelial cells through RAGE/JNK/NF-?B pathway.
23662689 2013 Crosstalk between Fas and JNK determines lymphocyte apoptosis after ionizing radiation.
23615449 2013 JNK1/2 regulates ER-mitochondrial Ca2+ cross-talk during IL-1?-mediated cell death in RINm5F and human primary ?-cells.
23608534 2013 Degradation of newly synthesized polypeptides by ribosome-associated RACK1/c-Jun N-terminal kinase/eukaryotic elongation factor 1A2 complex.
23608488 2013 IL-4 inhibition of IL-1 induced Matrix metalloproteinase-3 (MMP-3) expression in human fibroblasts involves decreased AP-1 activation via negative crosstalk involving of Jun N-terminal kinase (JNK).
23603344 Expression of NFkB1, GADD45A and JNK1 in salivary gland carcinomas of different histotypes.
23580093 2013 ER stress and ASK1-JNK activation contribute to oridonin-induced apoptosis and growth inhibition in cultured human hepatoblastoma HuH-6 cells.
23440494 2013 RNA interference-mediated FANCF silencing sensitizes OVCAR3 ovarian cancer cells to adriamycin through increased adriamycin-induced apoptosis dependent on JNK activation.
23416355 2013 JNK1?1 is phosphorylated during expression in E. coli and in vitro by MKK4 at three identical novel sites.
23397142 2013 Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.
23393199 2013 Hyperactivated JNK is a therapeutic target in pVHL-deficient renal cell carcinoma.
23359252 2013 ?1 integrins mediate resistance to ionizing radiation in vivo by inhibiting c-Jun amino terminal kinase 1.
23326144 2012 c-Jun N-terminal kinase is required for thermotherapy-induced apoptosis in human gastric cancer cells.
23290789 2013 Transglutaminase-2 induces N-cadherin expression in TGF-?1-induced epithelial mesenchymal transition via c-Jun-N-terminal kinase activation by protein phosphatase 2A down-regulation.
23273084 2013 c-Jun N-terminal kinase is upregulated in patients with hypospadias.
23258237 2013 Differential roles of JNK, ERK1/2, and p38 mitogen-activated protein kinases on endothelial cell tissue repair functions in response to tumor necrosis factor-?.
23237571 2013 Therapeutic effect of c-Jun N-terminal kinase inhibition on pancreatic cancer.
23077074 2012 Glucagon-like peptide-1 counteracts oxidative stress-dependent apoptosis of human cardiac progenitor cells by inhibiting the activation of the c-Jun N-terminal protein kinase signaling pathway.
23056263 2012 Khz (fusion of Ganoderma lucidum and Polyporus umbellatus mycelia) induces apoptosis by increasing intracellular calcium levels and activating JNK and NADPH oxidase-dependent generation of reactive oxygen species.
23051914 2012 Attenuation of TNFSF10/TRAIL-induced apoptosis by an autophagic survival pathway involving TRAF2- and RIPK1/RIP1-mediated MAPK8/JNK activation.
23020677 2012 Seven cysteine-deficient mutants depict the interplay between thermal and chemical stabilities of individual cysteine residues in mitogen-activated protein kinase c-Jun N-terminal kinase 1.
22942770 2012 The apoptotic volume decrease is an upstream event of MAP kinase activation during Staurosporine-induced apoptosis in HeLa cells.
22920299 2012 New insights into the mechanism of JNK1 inhibition by glutathione transferase P1-1.
22902540 2012 IL1? down-regulation of sex hormone-binding globulin production by decreasing HNF-4? via MEK-1/2 and JNK MAPK pathways.
22870247 2012 Increased JNK1 signaling pathway is responsible for ABCG2-mediated multidrug resistance in human colon cancer.
22850273 2012 BLyS expression and JNK activation may form a feedback loop to promote survival and proliferation of multiple myeloma cells.
22766602 2012 Inhibition of JNK-1 by small interfering RNA induces apoptotic signaling in PC-3 prostate cancer cells.
22763043 2012 Wnt5a activates THP-1 monocytic cells via a ?-catenin-independent pathway involving JNK and NF-?B activation.
22749438 2012 Mitogen-activated protein kinases-dependent induction of hepatocyte growth factor production in human dermal fibroblasts by the antibiotic polymyxin B.
22729748 2012 Flavokawain B induces apoptosis of non-small cell lung cancer H460 cells via Bax-initiated mitochondrial and JNK pathway.
22689214 2012 Effect of HSP70 and 90 in modulation of JNK, ERK expression in preeclamptic placental endothelial cell.
22509080 2012 HBx activates FasL and mediates HepG2 cell apoptosis through MLK3-MKK7-JNKs signal module.
22506718 2012 Centrifugal force induces human ligamentum flavum fibroblasts inflammation through activation of JNK and p38 pathways.
22493490 2012 Ectopic expression of human MutS homologue 2 on renal carcinoma cells is induced by oxidative stress with interleukin-18 promotion via p38 mitogen-activated protein kinase (MAPK) and c-Jun N-terminal kinase (JNK) signaling pathways.
22493283 2012 Osmotic stress regulates mammalian target of rapamycin (mTOR) complex 1 via c-Jun N-terminal Kinase (JNK)-mediated Raptor protein phosphorylation.
22456510 2012 c-Jun N-terminal kinase-mediated Rad18 phosphorylation facilitates Pol? recruitment to stalled replication forks.
22447977 2012 IL-15 can signal via IL-15R?, JNK, and NF-?B to drive RANTES production by myeloid cells.
22446103 2012 Estrogen regulates JNK1 genomic localization to control gene expression and cell growth in breast cancer cells.
22441692 2012 JNK regulates the photic response of the mammalian circadian clock.
22435755 2012 PKC-? mediates interferon-?-induced apoptosis through c-Jun NH?-terminal kinase activation.
22433870 2012 Tyrosine-phosphorylated caveolin-1 (Tyr-14) increases sensitivity to paclitaxel by inhibiting BCL2 and BCLxL proteins via c-Jun N-terminal kinase (JNK).
22394200 2012 JNK- and Akt-mediated Puma expression in the apoptosis of cisplatin-resistant ovarian cancer cells.
22363806 2012 Activation of JNK signaling mediates connective tissue growth factor expression and scar formation in corneal wound healing.
22357202 2012 Mitogen-activated protein kinases mediate Mycobacterium tuberculosis-induced CD44 surface expression in monocytes.
22351776 2012 Enzyme kinetics and interaction studies for human JNK1?1 and substrates activating transcription factor 2 (ATF2) and c-Jun N-terminal kinase (c-Jun).
22283740 2012 P53 activation plays a crucial role in silibinin induced ROS generation via PUMA and JNK.
22184250 2012 Site-specific ubiquitination is required for relieving the transcription factor Miz1-mediated suppression on TNF-?-induced JNK activation and inflammation.
22171160 2011 NF-?B feedback control of JNK1 activation modulates TRPV1-induced increases in IL-6 and IL-8 release by human corneal epithelial cells.
22164242 2011 Crosstalk between JNK and SUMO signaling pathways: deSUMOylation is protective against H2O2-induced cell injury.
22154358 Stress-activated kinase pathway alteration is a frequent event in bladder cancer.
22114267 2011 The loss of c-Jun N-terminal protein kinase activity prevents the amyloidogenic cleavage of amyloid precursor protein and the formation of amyloid plaques in vivo.
22100391 2012 Phosphorylation of the M3/6 dual-specificity phosphatase enhances the activation of JNK by arsenite.
22087220 2011 G12 signaling through c-Jun NH2-terminal kinase promotes breast cancer cell invasion.
22065586 2012 Oncogenic Ras and B-Raf proteins positively regulate death receptor 5 expression through co-activation of ERK and JNK signaling.
22027397 2011 HIV-1 and IL-1? regulate astrocytic CD38 through mitogen-activated protein kinases and nuclear factor-?B signaling mechanisms.
22021110 2012 Ganoderma lucidum polysaccharides prevent platelet-derived growth factor-stimulated smooth muscle cell proliferation in vitro and neointimal hyperplasia in the endothelial-denuded artery in vivo.
22014979 2012 JNK signaling activity regulates cell-cell adhesions via TM4SF5-mediated p27(Kip1) phosphorylation.
22005259 2011 NF-?B, JNK and p53 pathways are involved in tubeimoside-1-induced apoptosis in HepG2 cells with oxidative stress and G?/M cell cycle arrest.
21984578 2011 PTPN2, a candidate gene for type 1 diabetes, modulates pancreatic ?-cell apoptosis via regulation of the BH3-only protein Bim.
21964465 2012 Activation of estrogen receptor ? by raloxifene through an activating protein-1-dependent tethering mechanism in human cervical epithelial cancer cells: a role for c-Jun N-terminal kinase.
21959987 2012 The biphasic nature of hypoxia-induced directional migration of activated human hepatic stellate cells.
21943220 2011 c-Jun NH2-terminal kinase activation is essential for up-regulation of LC3 during ceramide-induced autophagy in human nasopharyngeal carcinoma cells.
21931671 2011 Combinatorial effect of non-steroidal anti-inflammatory drugs and NF-?B inhibitors in ovarian cancer therapy.
21863240 2012 Impact of JNK1, JNK2, and ligase Itch on reactive oxygen species formation and survival of prostate cancer cells treated with diallyl trisulfide.
21856198 2011 JNK1 phosphorylation of Cdt1 inhibits recruitment of HBO1 histone acetylase and blocks replication licensing in response to stress.
21822690 2012 Role of JNK-1 regulation in the protection of contact-inhibited fibroblasts from oxidative stress.
21817106 2011 Oxidized low-density lipoprotein activates p66Shc via lectin-like oxidized low-density lipoprotein receptor-1, protein kinase C-beta, and c-Jun N-terminal kinase kinase in human endothelial cells.
21775054 2011 Co-administration of perifosine with paclitaxel synergistically induces apoptosis in ovarian cancer cells: more than just AKT inhibition.
21768777 2011 Vinblastine sensitizes leukemia cells to cyclin-dependent kinase inhibitors, inducing acute cell cycle phase-independent apoptosis.
21764057 2011 Oxidized low density lipoprotein induces cyclin A synthesis. Involvement of ERK, JNK and NFkappaB.
21757743 2011 Gq protein-induced apoptosis is mediated by AKT kinase inhibition that leads to protein kinase C-induced c-Jun N-terminal kinase activation.
21752354 2011 Stimulation of Fas (CD95) induces production of pro-inflammatory mediators through ERK/JNK-dependent activation of NF-?B in THP-1 cells.
21729547 2011 [Effect of different concentrations of bortezomib on the expression of ERK, JNK and P38 in daunorubicin-resistant K562 cells].
21719561 2011 Breast cancer cells proliferation is regulated by tyrosine phosphatase SHP1 through c-jun N-terminal kinase and cooperative induction of RFX-1 and AP-4 transcription factors.
21697181 2011 Contribution of persistent C-Jun N-terminal kinase activity to the survival of human vestibular schwannoma cells by suppression of accumulation of mitochondrial superoxides.
21660049 2012 A critical step for JNK activation: isomerization by the prolyl isomerase Pin1.
21629969 Inhibition of c-Jun N-terminal kinase attenuates low shear stress-induced atherogenesis in apolipoprotein E-deficient mice.
21526344 2011 Increased JNK1 activity contributes to the upregulation of ApoD in the apocrine secretory gland cells from axillary osmidrosis.
21524306 2011 The natural triterpene maslinic acid induces apoptosis in HT29 colon cancer cells by a JNK-p53-dependent mechanism.
21511059 2011 Protective effect of kobophenol A on nitric oxide-induced cell apoptosis in human osteoblast-like MG-63 cells: involvement of JNK, NF-?B and AP-1 pathways.
21504622 2011 Activation of NAG-1 via JNK signaling revealed an isochaihulactone-triggered cell death in human LNCaP prostate cancer cells.
21465527 2011 PTH regulates myleoid ELF-1-like factor (MEF)-induced MAB-21-like-1 (MAB21L1) expression through the JNK1 pathway.
21454558 2011 Mitochondrial c-Jun N-terminal kinase (JNK) signaling initiates physiological changes resulting in amplification of reactive oxygen species generation.
21439937 2011 c-Jun localizes to the nucleus independent of its phosphorylation by and interaction with JNK and vice versa promotes nuclear accumulation of JNK.
21384452 2011 GST pi modulates JNK activity through a direct interaction with JNK substrate, ATF2.
21378396 2011 Cellular iron depletion stimulates the JNK and p38 MAPK signaling transduction pathways, dissociation of ASK1-thioredoxin, and activation of ASK1.
21364637 2010 JNK phosphorylates Yes-associated protein (YAP) to regulate apoptosis.
21364631 2010 Role of the JNK/c-Jun/AP-1 signaling pathway in galectin-1-induced T-cell death.
21362231 2011 [Hyperactivation of c-Jun NH(2)-terminal protein kinase contributes to the proliferation of B lymphoma cells].
21269460 2011 Initial characterization of the human central proteome.
21237154 2011 Disassembly of the JIP1/JNK molecular scaffold by caspase-3-mediated cleavage of JIP1 during apoptosis.
21223552 2011 A human ribonuclease induces apoptosis associated with p21WAF1/CIP1 induction and JNK inactivation.
21212517 2011 Role of FGD1, a Cdc42 guanine nucleotide exchange factor, in epidermal growth factor-stimulated c-Jun NH2-terminal kinase activation and cell migration.
21191018 2011 JNK1 is required for lentivirus entry and gene transfer.
21187925 2010 p38 MAPK and JNK antagonistically control senescence and cytoplasmic p16INK4A expression in doxorubicin-treated endothelial progenitor cells.
21172010 2010 c-Jun NH2-terminal kinase-dependent upregulation of DR5 mediates cooperative induction of apoptosis by perifosine and TRAIL.
21152872 2011 MEKK1/MEKK4 are responsible for TRAIL-induced JNK/p38 phosphorylation.
21148313 2011 Peroxiredoxin II restrains DNA damage-induced death in cancer cells by positively regulating JNK-dependent DNA repair.
21148294 2011 Defective anchoring of JNK1 in the cytoplasm by MKK7 in Jurkat cells is associated with resistance to Fas-mediated apoptosis.
21145111 2011 IL-17R activation of human periodontal ligament fibroblasts induces IL-23 p19 production: Differential involvement of NF-?B versus JNK/AP-1 pathways.
21134350 2011 Androgen receptor-mediated regulation of the anti-atherogenic enzyme CYP27A1 involves the JNK/c-jun pathway.
21123173 2011 Deactivation of STAT6 through serine 707 phosphorylation by JNK.
21122381 2010 [Expression and significance of JNK1, Raf-1 and Livin in the carcinogenesis of sporadic colorectal tubular adenoma].
21106355 2012 PKC? inhibited apoptosis by decreasing the activity of JNK in MCF-7/ADR cells.
21095239 2011 Phosphorylation of Bcl-associated death protein (Bad) by erythropoietin-activated c-Jun N-terminal protein kinase 1 contributes to survival of erythropoietin-dependent cells.
20944115 2010 Jun amino-terminal kinase 1 activation promotes cell survival in ErbB2-positive breast cancer.
20919940 2011 Oscillatory shear stress induces mitochondrial superoxide production: implication of NADPH oxidase and c-Jun NH2-terminal kinase signaling.
20878914 2010 DNA-dependent protein kinase catalytic subunit mediates T-cell loss in rheumatoid arthritis.
20870032 2010 Chlamydia pneumoniae disturbs cholesterol homeostasis in human THP-1 macrophages via JNK-PPAR? dependent signal transduction pathways.
20829350 2010 Polymeric immunoglobulin receptor-mediated invasion of Streptococcus pneumoniae into host cells requires a coordinate signaling of SRC family of protein-tyrosine kinases, ERK, and c-Jun N-terminal kinase.
20735357 2010 Involvement of c-Jun N-terminal kinase and extracellular signal-regulated kinase 1/2 in EGF-induced angiogenesis.
20717968 2011 Interaction of profilin-1 and F-actin via a ?-arrestin-1/JNK signaling pathway involved in prostaglandin E(2)-induced human mesenchymal stem cells migration and proliferation.
20680486 2010 Control of TrkA-induced cell death by JNK activation and differential expression of TrkA upon DNA damage.
20648623 2010 Reactive oxygen species control senescence-associated matrix metalloproteinase-1 through c-Jun-N-terminal kinase.
20647313 2010 The effects of palmitate on hepatic insulin resistance are mediated by NADPH Oxidase 3-derived reactive oxygen species through JNK and p38MAPK pathways.
20632440 2010 8-Bromo-7-methoxychrysin-induced apoptosis of hepatocellular carcinoma cells involves ROS and JNK.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20622336 2010 [Involvement of JNK signal transduction pathway in endothelial cell apoptosis induced by intermittent high glucose].
20581839 2010 Interplay between Cdh1 and JNK activity during the cell cycle.
20573157 2010 High glucose induces apoptosis in AC16 human cardiomyocytes via macrophage migration inhibitory factor and c-Jun N-terminal kinase.
20566643 2010 Regulation of prostate cancer cell survival by protein kinase Cepsilon involves bad phosphorylation and modulation of the TNFalpha/JNK pathway.
20551953 2010 DUSP16 is an epigenetically regulated determinant of JNK signalling in Burkitt's lymphoma.
20525557 2010 JNK1, JNK2, and JNK3 are involved in P-glycoprotein-mediated multidrug resistance of hepatocellular carcinoma cells.
20512919 2010 ASK1-JNK signaling cascade mediates Ad-ST13-induced apoptosis in colorectal HCT116 cells.
20511226 2010 Targeting of tumor necrosis factor receptor 1 to low density plasma membrane domains in human endothelial cells.
20495362 2010 The oncogenic and growth-suppressive functions of the integrin-linked kinase are distinguished by JNK1 expression in human cancer cells.
20490718 2011 Inhibition of JNK1 expression decreases migration and invasion of mouse hepatocellular carcinoma cell line in vitro.
20483734 2010 Thymic stromal lymphopoietin receptor-mediated IL-6 and CC/CXC chemokines expression in human airway smooth muscle cells: role of MAPKs (ERK1/2, p38, and JNK) and STAT3 pathways.
20483637 2010 JNK1 and JNK2 differently regulate IL-12 production in THP-1 macrophage cells.
20452983 2010 The PEA-15 protein regulates autophagy via activation of JNK.
20450729 2010 [Involvement of JNK and caspase-3 in human lymphoma cell apoptosis induced by Prunella vulgaris].
20432452 2010 Interleukin-1beta induces ICAM-1 expression enhancing leukocyte adhesion in human rheumatoid arthritis synovial fibroblasts: involvement of ERK, JNK, AP-1, and NF-kappaB.
20371626 2010 JNK1 and IKKbeta: molecular links between obesity and metabolic dysfunction.
20225236 2010 IL-6 and high glucose synergistically upregulate MMP-1 expression by U937 mononuclear phagocytes via ERK1/2 and JNK pathways and c-Jun.
20173753 2010 Concerted action of cellular JNK and Pin1 restricts HIV-1 genome integration to activated CD4+ T lymphocytes.
20156194 2010 Filamin associates with stress signalling kinases MKK7 and MKK4 and regulates JNK activation.
20150185 2010 Mixed lineage kinase-3/JNK1 axis promotes migration of human gastric cancer cells following gastrin stimulation.
20145041 2010 Sustained c-Jun-NH2-kinase activity promotes epithelial-mesenchymal transition, invasion, and survival of breast cancer cells by regulating extracellular signal-regulated kinase activation.
20142324 2010 Transforming growth factor-?1 induces expression of human coagulation factor XII via Smad3 and JNK signaling pathways in human lung fibroblasts.
20139358 2010 Oxidized low-density lipoprotein-activated c-Jun NH2-terminal kinase regulates manganese superoxide dismutase ubiquitination: implication for mitochondrial redox status and apoptosis.
20138424 2010 Phosphorylated c-Jun NH2-terminal kinase is overexpressed in human papillary thyroid carcinomas and associates with lymph node metastasis.
20130137 2010 The PI3K/Akt pathway inhibits influenza A virus-induced Bax-mediated apoptosis by negatively regulating the JNK pathway via ASK1.
20116378 2010 JNK-ATF-2 inhibits thrombomodulin (TM) expression by recruiting histone deacetylase4 (HDAC4) and forming a transcriptional repression complex in the TM promoter.
20103647 2010 Resveratrol promotes autophagic cell death in chronic myelogenous leukemia cells via JNK-mediated p62/SQSTM1 expression and AMPK activation.
20088952 2010 CRK adaptor protein expression is required for efficient replication of avian influenza A viruses and controls JNK-mediated apoptotic responses.
20086174 2010 Proapoptotic kinase MST2 coordinates signaling crosstalk between RASSF1A, Raf-1, and Akt.
20074375 2010 GnRH I and II up-regulate MMP-26 expression through the JNK pathway in human cytotrophoblasts.
20070945 2010 TRPM7 activates m-calpain by stress-dependent stimulation of p38 MAPK and c-Jun N-terminal kinase.
20070836 2010 Effects of UVA on TNF-alpha, IL-1beta, and IL-10 expression levels in human keratinocytes and intervention studies with an antioxidant and a JNK inhibitor.
20069553 2010 Activation and induction of cytosolic phospholipase A2 by IL-1beta in human tracheal smooth muscle cells: role of MAPKs/p300 and NF-kappaB.
20060003 2010 Cellular repressor of E1A-stimulated genes inhibits human vascular smooth muscle cell apoptosis via blocking P38/JNK MAP kinase activation.
20056910 2010 c-Jun N-terminal kinase primes endothelial cells at atheroprone sites for apoptosis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20027304 2009 JNK1 phosphorylates SIRT1 and promotes its enzymatic activity.
20018857 2010 Cyclic mechanical stretch decreases cell migration by inhibiting phosphatidylinositol 3-kinase- and focal adhesion kinase-mediated JNK1 activation.
19996270 2009 Basal c-Jun NH2-terminal protein kinase activity is essential for survival and proliferation of T-cell acute lymphoblastic leukemia cells.
19995557 2010 Increase of RhoB in gamma-radiation-induced apoptosis is regulated by c-Jun N-terminal kinase in Jurkat T cells.
19966288 2010 JNK-mediated turnover and stabilization of the transcription factor p45/NF-E2 during differentiation of murine erythroleukemia cells.
19940360 2009 Fas-induced apoptosis of renal cell carcinoma is mediated by apoptosis signal-regulating kinase 1 via mitochondrial damage-dependent caspase-8 activation.
19940138 2010 c-Jun regulates shear- and injury-inducible Egr-1 expression, vein graft stenosis after autologous end-to-side transplantation in rabbits, and intimal hyperplasia in human saphenous veins.
19937141 2009 Activation of JNK and c-Jun is involved in glucose oxidase-mediated cell death of human lymphoma cells.
19923798 2010 JNK/ATF2 pathway is involved in iodinated contrast media-induced apoptosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910486 2010 A novel c-Jun N-terminal kinase (JNK)-binding protein WDR62 is recruited to stress granules and mediates a nonclassical JNK activation.
19901160 2010 Induction of mitogen-activated protein kinases is proportional to the amount of pressure overload.
19900593 2010 c-Jun N-terminal kinase (JNK) signaling: recent advances and challenges.
19893453 2009 Caveolin-1 acts as a tumor suppressor by down-regulating epidermal growth factor receptor-mitogen-activated protein kinase signaling pathway in pancreatic carcinoma cell lines.
19877043 2009 Gadd45beta deficiency in rheumatoid arthritis: enhanced synovitis through JNK signaling.
19864026 2009 Involvement of the c-jun N-terminal kinases JNK1 and JNK2 in complement-mediated cell death.
19862774 2009 Triggering of DC migration by dengue virus stimulation of COX-2-dependent signaling cascades in vitro highlights the significance of these cascades beyond inflammation.
19859790 2010 c-Jun-NH2 terminal kinase (JNK)-mediates AP-1 activation by thioredoxin: phosphorylation of cJun, JunB, and Fra-1.
19822666 2009 MST kinases monitor actin cytoskeletal integrity and signal via c-Jun N-terminal kinase stress-activated kinase to regulate p21Waf1/Cip1 stability.
19822148 2009 Prolonged cigarette smoke exposure decreases heme oxygenase-1 and alters Nrf2 and Bach1 expression in human macrophages: roles of the MAP kinases ERK(1/2) and JNK.
19815509 2009 Miz1 is a signal- and pathway-specific modulator or regulator (SMOR) that suppresses TNF-alpha-induced JNK1 activation.
19806201 2009 Basal cancer cell survival involves JNK2 suppression of a novel JNK1/c-Jun/Bcl-3 apoptotic network.
19803394 2009 [JNK signaling in osteoblast differentiation].
19802005 2010 Frat oncoproteins act at the crossroad of canonical and noncanonical Wnt-signaling pathways.
19801633 2009 Cyclin D1 induction by benzo[a]pyrene-7,8-diol-9,10-epoxide via the phosphatidylinositol 3-kinase/Akt/MAPK- and p70s6k-dependent pathway promotes cell transformation and tumorigenesis.
19782079 2010 Modulation of hepatic fibrosis by c-Jun-N-terminal kinase inhibition.
19778898 2009 JNK and ceramide kinase govern the biogenesis of lipid droplets through activation of group IVA phospholipase A2.
19748889 2009 Suppression of p38 MAPK and JNK via Akt-mediated inhibition of apoptosis signal-regulating kinase 1 constitutes a core component of the beta-cell pro-survival effects of glucose-dependent insulinotropic polypeptide.
19723627 2009 Androgen via p21 inhibits tumor necrosis factor alpha-induced JNK activation and apoptosis.
19723092 2009 Phloretin induces apoptosis in H-Ras MCF10A human breast tumor cells through the activation of p53 via JNK and p38 mitogen-activated protein kinase signaling.
19695707 2009 Characterization of CRTAM gene promoter: AP-1 transcription factor control its expression in human T CD8 lymphocytes.
19693773 2009 Involvement of the JNK activation in terbinafine-induced p21 up-regulation and DNA synthesis inhibition in human vascular endothelial cells.
19690982 2010 Livin abrogates apoptosis of SPC-A1 cell by regulating JNKI signaling pathway.
19686584 2009 JNK1 activation predicts the prognostic outcome of the human hepatocellular carcinoma.
19676104 2010 Betuletol 3-methyl ether induces G(2)-M phase arrest and activates the sphingomyelin and MAPK pathways in human leukemia cells.
19667122 2009 JNK phosphorylates beta-catenin and regulates adherens junctions.
19664626 2009 FGF2 stimulates the proliferation of human mesenchymal stem cells through the transient activation of JNK signaling.
19638579 2009 Stress-activated mitogen-activated protein kinases c-Jun NH2-terminal kinase and p38 target Cdc25B for degradation.
19620725 2009 The JNKs differentially regulate RNA polymerase III transcription by coordinately modulating the expression of all TFIIIB subunits.
19616043 2009 Basic fibroblast growth factor upregulates adrenomedullin expression in ovarian epithelial carcinoma cells via JNK-AP-1 pathway.
19604147 2009 Mammalian sterile 20-like kinase 3 (MST3) mediates oxidative-stress-induced cell death by modulating JNK activation.
19596001 2009 Hypothermia attenuates ischemia/reperfusion-induced endothelial cell apoptosis via alterations in apoptotic pathways and JNK signaling.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19589256 The role of c-Jun N-terminal kinases 1/2 in transforming growth factor beta(1)-induced expression of connective tissue growth factor and scar formation in the cornea.
19574423 2009 Mechanical stretch decreases FAK phosphorylation and reduces cell migration through loss of JIP3-induced JNK phosphorylation in airway epithelial cells.
19570911 2009 REDOX reaction at ASK1-Cys250 is essential for activation of JNK and induction of apoptosis.
19567513 2009 c-Jun N-terminal kinase 1/2 activation by tumor necrosis factor-alpha induces insulin resistance in human visceral but not subcutaneous adipocytes: reversal by liver X receptor agonists.
19527717 2009 A selective small-molecule inhibitor of c-Jun N-terminal kinase 1.
19523467 2009 PKCeta confers protection against apoptosis by inhibiting the pro-apoptotic JNK activity in MCF-7 cells.
19478459 2009 JNK1 determines the oncogenic or tumor-suppressive activity of the integrin-linked kinase in human rhabdomyosarcoma.
19468799 2009 Enediyne lidamycin induces apoptosis in human multiple myeloma cells through activation of p38 mitogen-activated protein kinase and c-Jun NH2-terminal kinase.
19454725 2009 Lipopolysaccharide-induced apoptosis in transformed bovine brain endothelial cells and human dermal microvessel endothelial cells: the role of JNK.
19424800 2009 c-Jun N-terminal kinase regulates apoptosis in endometrial cancer cells.
19418584 2009 Components of the mitogen-activated protein kinase cascade are activated in hepatic cells by Echinococcus multilocularis metacestode.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19352384 2009 Differential activation of JNK1 isoforms by TRAIL receptors modulate apoptosis of colon cancer cell lines.
19351724 2009 Activated Ask1-MKK4-p38MAPK/JNK stress signaling pathway in human omental fat tissue may link macrophage infiltration to whole-body Insulin sensitivity.
19339050 2009 c-Jun N-terminal kinase 2 (JNK2) antagonizes the signaling of differentiation by JNK1 in human myeloid leukemia cells resistant to vitamin D.
19286999 2009 NPM-ALK inhibits the p53 tumor suppressor pathway in an MDM2 and JNK-dependent manner.
19248119 2009 Tumor necrosis factor alpha-induced interleukin-32 is positively regulated via the Syk/protein kinase Cdelta/JNK pathway in rheumatoid synovial fibroblasts.
19234442 2009 Tyrosine dephosphorylation of H2AX modulates apoptosis and survival decisions.
19206162 2009 Mechanical force induces type I collagen expression in human periodontal ligament fibroblasts through activation of ERK/JNK and AP-1.
19194824 2009 Thymosin beta-10 is aberrantly expressed in pancreatic cancer and induces JNK activation.
19168796 2009 Proteomics and pathway analysis identifies JNK signaling as critical for high linear energy transfer radiation-induced apoptosis in non-small lung cancer cells.
19166930 2009 Adrenomedullin promotes cell cycle transit and up-regulates cyclin D1 protein level in human glioblastoma cells through the activation of c-Jun/JNK/AP-1 signal transduction pathway.
19166818 2009 Crystal structure of SCCA1 and insight about the interaction with JNK1.
19159663 2009 Glutathione S-transferase pi regulates UV-induced JNK signaling in SH-SY5Y neuroblastoma cells.
19154785 2009 Ultrafine particles from diesel engines induce vascular oxidative stress via JNK activation.
19097143 2009 IL-1 beta induces urokinase-plasminogen activator expression and cell migration through PKC alpha, JNK1/2, and NF-kappaB in A549 cells.
19074436 2009 Melittin, a major component of bee venom, sensitizes human hepatocellular carcinoma cells to tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced apoptosis by activating CaMKII-TAK1-JNK/p38 and inhibiting IkappaBalpha kinase-NFkappaB.
19071215 2009 Up-regulation of SEPT9_v1 stabilizes c-Jun-N-terminal kinase and contributes to its pro-proliferative activity in mammary epithelial cells.
19069644 2008 [Synergistic effect of thermotherapy in combination with chemotherapy on lung tumor A549 cells growth through activation of c-Jun N-terminal kinase and inhibition of heat shock protein70 expression].
19060920 2009 The pivotal role of c-Jun NH2-terminal kinase-mediated Beclin 1 expression during anticancer agents-induced autophagy in cancer cells.
19056926 2009 c-Jun N-terminal kinase (JNK1) upregulates XIAP-associated factor 1 (XAF1) through interferon regulatory factor 1 (IRF-1) in gastrointestinal cancer.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
19052872 2009 Involvement of c-Abl, p53 and the MAP kinase JNK in the cell death program initiated in A2E-laden ARPE-19 cells by exposure to blue light.
19041150 2009 Sustained JNK1 activation is associated with altered histone H3 methylations in human liver cancer.
19037093 2009 AMP kinase signaling determines whether c-Jun N-terminal kinase promotes survival or apoptosis during glucose deprivation.
19036714 2008 Identification of ROCK1 as an upstream activator of the JIP-3 to JNK signaling axis in response to UVB damage.
19033664 2008 Proliferation of human HCC cells and chemically induced mouse liver cancers requires JNK1-dependent p21 downregulation.
18996088 2008 Fas-mediated autophagy requires JNK activation in HeLa cells.
18989785 2008 Involvement of endoplasmic reticulum stress in Docetaxel-induced JNK-dependent apoptosis of human melanoma.
18982452 2008 Regulation of IGFBP6 gene and protein is mediated by the inverse expression and function of c-jun N-terminal kinase (JNK) and NFkappaB in a model of oral tumor cells.
18979912 2008 [Changes of phospho-JNK expression during the skin burned wound healing].
18978303 2009 Dynasore, a dynamin inhibitor, induces PAI-1 expression in MeT-5A human pleural mesothelial cells.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18936517 2009 Protein kinase C activation stabilizes LDL receptor mRNA via the JNK pathway in HepG2 cells.
18922473 2008 TRAF6 mediates Smad-independent activation of JNK and p38 by TGF-beta.
18845538 2008 Parkin regulates Eg5 expression by Hsp70 ubiquitination-dependent inactivation of c-Jun NH2-terminal kinase.
18818208 2008 JNK-mediated phosphorylation of paxillin in adhesion assembly and tension-induced cell death by the adenovirus death factor E4orf4.
18815275 2008 Filamin B serves as a molecular scaffold for type I interferon-induced c-Jun NH2-terminal kinase signaling pathway.
18782768 2008 MKP1 regulates the induction of MUC5AC mucin by Streptococcus pneumoniae pneumolysin by inhibiting the PAK4-JNK signaling pathway.
18769111 2008 Dual role of JNK1-mediated phosphorylation of Bcl-2 in autophagy and apoptosis regulation.
18757369 2008 Blockade of the RhoA-JNK-c-Jun-MMP2 cascade by atorvastatin reduces osteosarcoma cell invasion.
18723442 2008 Increased endothelial mitogen-activated protein kinase phosphatase-1 expression suppresses proinflammatory activation at sites that are resistant to atherosclerosis.
18718914 2008 15-deoxy-Delta(12,14)-prostaglandin J2 induces vascular endothelial cell apoptosis through the sequential activation of MAPKS and p53.
18713996 2008 Synoviocyte innate immune responses: I. Differential regulation of interferon responses and the JNK pathway by MAPK kinases.
18713649 2008 JNK regulates cell migration through promotion of tyrosine phosphorylation of paxillin.
18703151 2008 Downregulation of cyclin D1-CDK4 protein in human embryonic lung fibroblasts (HELF) induced by silica is mediated through the ERK and JNK pathway.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18682391 2008 Histamine induces Egr-1 expression in human aortic endothelial cells via the H1 receptor-mediated protein kinase Cdelta-dependent ERK activation pathway.
18681908 2009 SIRT1 confers protection against UVB- and H2O2-induced cell death via modulation of p53 and JNK in cultured skin keratinocytes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18667537 2008 Tumor necrosis factor-alpha-elicited stimulation of gamma-secretase is mediated by c-Jun N-terminal kinase-dependent phosphorylation of presenilin and nicastrin.
18663379 2008 Induction of apoptosis by shikonin through a ROS/JNK-mediated process in Bcr/Abl-positive chronic myelogenous leukemia (CML) cells.
18651223 2008 JNK mediates UVB-induced apoptosis upstream lysosomal membrane permeabilization and Bcl-2 family proteins.
18636174 2008 M-RIP, a novel target of JNK signaling and a requirement for human cancer cell invasion.
18620777 2008 The JNK inhibitor SP600129 enhances apoptosis of HCC cells induced by the tumor suppressor WWOX.
18603327 2008 Regulation of human beta-defensin-2 by Mycobacterium bovis bacillus Calmette-Guérin (BCG): involvement of PKC, JNK, and PI3K in human lung epithelial cell line (A549).
18594007 2008 Moscatilin induces apoptosis in human colorectal cancer cells: a crucial role of c-Jun NH2-terminal protein kinase activation caused by tubulin depolymerization and DNA damage.
18573678 2008 Expression of pokeweed antiviral protein in mammalian cells activates c-Jun NH2-terminal kinase without causing apoptosis.
18570871 2008 JNK1-mediated phosphorylation of Bcl-2 regulates starvation-induced autophagy.
18547751 2008 The apoptotic effect of nanosilver is mediated by a ROS- and JNK-dependent mechanism involving the mitochondrial pathway in NIH3T3 cells.
18541008 2008 JNK supports survival in melanoma cells by controlling cell cycle arrest and apoptosis.
18540881 2008 Active c-jun N-terminal kinase induces caspase cleavage of tau and additional phosphorylation by GSK-3beta is required for tau aggregation.
18524773 2008 FoxM1 regulates transcription of JNK1 to promote the G1/S transition and tumor cell invasiveness.
18506470 2008 Expression and regulation of c-Jun N-terminal kinase (JNK) in endometrial cells in vivo and in vitro.
18495129 2009 Anthocyanin attenuates CD40-mediated endothelial cell activation and apoptosis by inhibiting CD40-induced MAPK activation.
18457359 2008 Inhibition of MITF and tyrosinase by paeonol-stimulated JNK/SAPK to reduction of phosphorylated CREB.
18439101 2008 Distinct role of c-Jun N-terminal kinase isoforms in human neutrophil apoptosis regulated by tumor necrosis factor-alpha and granulocyte-macrophage colony-stimulating factor.
18429822 2008 Negative regulation of constitutive NF-kappaB and JNK signaling by PKN1-mediated phosphorylation of TRAF1.
18405916 2008 Involvement of connexin 43 in angiotensin II-induced migration and proliferation of saphenous vein smooth muscle cells via the MAPK-AP-1 signaling pathway.
18401423 2008 Tie2-R849W mutant in venous malformations chronically activates a functional STAT1 to modulate gene expression.
18373696 2008 Ionizing radiation utilizes c-Jun N-terminal kinase for amplification of mitochondrial apoptotic cell death in human cervical cancer cells.
18356158 2008 The beta1 integrin activates JNK independent of CagA, and JNK activation is required for Helicobacter pylori CagA+-induced motility of gastric cancer cells.
18348163 2008 JNK modulates the effect of caspases and NF-kappaB in the TNF-alpha-induced down-regulation of Na+/K+ATPase in HepG2 cells.
18344085 2008 [Study on the mechanism of DDP-resistance mediated by phosphate JNK in gastric cancer].
18337589 2008 Cross talk of signaling pathways in the regulation of the glucocorticoid receptor function.
18325654 2008 Involvement of oxidative stress-activated JNK signaling in the methamphetamine-induced cell death of human SH-SY5Y cells.
18316603 2008 DNA damage-dependent translocation of B23 and p19 ARF is regulated by the Jun N-terminal kinase pathway.
18316600 2008 p21 Waf1/Cip1 expression by curcumin in U-87MG human glioma cells: role of early growth response-1 expression.
18307971 2008 Phosphorylation of two eukaryotic transcription factors, Jun dimerization protein 2 and activation transcription factor 2, in Escherichia coli by Jun N-terminal kinase 1.
18297686 2008 TNF-alpha represses connexin43 expression in HaCat keratinocytes via activation of JNK signaling.
18293403 2008 Transforming growth factor-activated kinase 1 induced in spinal astrocytes contributes to mechanical hypersensitivity after nerve injury.
18292600 2008 AIP1 recruits phosphatase PP2A to ASK1 in tumor necrosis factor-induced ASK1-JNK activation.
18288129 2008 Lack of the leukocyte-associated Ig-like receptor-1 expression in high-risk chronic lymphocytic leukaemia results in the absence of a negative signal regulating kinase activation and cell division.
18286207 2008 Modulation of interleukin-1 transcriptional response by the interaction between VRK2 and the JIP1 scaffold protein.
18276794 2008 SHP-1 inhibition by 4-hydroxynonenal activates Jun N-terminal kinase and glutamate cysteine ligase.
18256527 2008 Basal c-Jun N-terminal kinases promote mitotic progression through histone H3 phosphorylation.
18253836 2008 MAP kinase pathways in UV-induced apoptosis of retinal pigment epithelium ARPE19 cells.
18249102 2008 The toxic effect of pyrrolizidine alkaloid clivorine on the human embryonic kidney 293 cells and its primary mechanism.
18219313 2008 NLRX1 is a mitochondrial NOD-like receptor that amplifies NF-kappaB and JNK pathways by inducing reactive oxygen species production.
18218857 2008 C-Jun NH2 terminal kinase (JNK) is an essential mediator of Toll-like receptor 2-induced corneal inflammation.
18212053 2008 Wnt-3a and Dickkopf-1 stimulate neurite outgrowth in Ewing tumor cells via a Frizzled3- and c-Jun N-terminal kinase-dependent mechanism.
18199680 2008 Phosphorylation by c-Jun NH2-terminal kinase 1 regulates the stability of transcription factor Sp1 during mitosis.
18181766 2008 Both ERK and JNK are required for enhancement of MD-2 gene expression during differentiation of HL-60 cells.
18164704 2008 JNK signaling pathway is required for bFGF-mediated surface cadherin downregulation on HUVEC.
18094581 2007 [Treatment outcome of multidrug resistance related mRNA expression and c-jun-N-terminal kinase activity in patients with acute myeloid leukemia].
18087676 2008 CCDC134, a novel secretory protein, inhibits activation of ERK and JNK, but not p38 MAPK.
18086557 2008 Protease-activated receptor (PAR)-induced interleukin-8 production in airway epithelial cells requires activation of MAP kinases p44/42 and JNK.
18082745 2008 Activation and dysregulation of the unfolded protein response in nonalcoholic fatty liver disease.
18055217 2008 SOCS3 suppresses AP-1 transcriptional activity in neuroblastoma cells through inhibition of c-Jun N-terminal kinase.
18036196 2008 The G/G genotype of a single nucleotide polymorphism at -1066 of c-Jun N-terminal kinase 1 gene (MAPK8) does not affect type 2 diabetes susceptibility despite the specific binding of AP2alpha.
18025271 2007 Roles of human epidermal growth factor receptor 2, c-jun NH2-terminal kinase, phosphoinositide 3-kinase, and p70 S6 kinase pathways in regulation of cyclin G2 expression in human breast cancer cells.
17982228 2007 House dust mite induces expression of intercellular adhesion molecule-1 in EoL-1 human eosinophilic leukemic cells.
17967471 2008 The c-Jun N-terminal kinase pathway is critical for cell transformation by the latent membrane protein 1 of Epstein-Barr virus.
17942603 2008 Interferon alpha induces nucleus-independent apoptosis by activating extracellular signal-regulated kinase 1/2 and c-Jun NH2-terminal kinase downstream of phosphatidylinositol 3-kinase and mammalian target of rapamycin.
17933493 2008 Sequential activation of protein kinase C delta and JNK is required for interferon-alpha-induced expression of IFIT4.
17913539 2007 Chlamydophilal antigens induce foam cell formation via c-Jun NH2-terminal kinase.
17908987 2007 Inhibition of Jun NH2-terminal kinases suppresses the growth of experimental head and neck squamous cell carcinoma.
17904874 2007 Induction of endoreduplication by a JNK inhibitor SP600125 in human lung carcinoma A 549 cells.
17883418 2008 Histone-like DNA binding protein of Streptococcus intermedius induces the expression of pro-inflammatory cytokines in human monocytes via activation of ERK1/2 and JNK pathways.
17875713 2007 Nuclear factor of activated T3 is a negative regulator of Ras-JNK1/2-AP-1 induced cell transformation.
17785464 2007 Involvement of the mitogen-activated protein kinase c-Jun NH2-terminal kinase 1 in thrombus formation.
17719653 2007 Intracellular JNK, p38 MAPK and NF-kappaB regulate IL-25 induced release of cytokines and chemokines from costimulated T helper lymphocytes.
17704768 2007 The F-box protein Fbl10 is a novel transcriptional repressor of c-Jun.
17703233 2007 DAP kinase regulates JNK signaling by binding and activating protein kinase D under oxidative stress.
17702750 2007 Long-acting kappa opioid antagonists disrupt receptor signaling and produce noncompetitive effects by activating c-Jun N-terminal kinase.
17699782 2007 Regulation of PTEN expression in intestinal epithelial cells by c-Jun NH2-terminal kinase activation and nuclear factor-kappaB inhibition.
17693927 2008 PP2A regulates upstream members of the c-jun N-terminal kinase mitogen-activated protein kinase signaling pathway.
17690186 2007 c-Jun NH2 terminal kinase activation and decreased expression of mitogen-activated protein kinase phosphatase-1 play important roles in invasion and angiogenesis of urothelial carcinomas.
17652454 2007 Disulfide Bond-mediated multimerization of Ask1 and its reduction by thioredoxin-1 regulate H(2)O(2)-induced c-Jun NH(2)-terminal kinase activation and apoptosis.
17640761 2007 Stabilization of IGFBP-1 mRNA by ethanol in hepatoma cells involves the JNK pathway.
17626013 2007 Constitutive activation of TAK1 by HTLV-1 tax-dependent overexpression of TAB2 induces activation of JNK-ATF2 but not IKK-NF-kappaB.
17620321 2007 Activin receptor-like kinase 1 inhibits human microvascular endothelial cell migration: potential roles for JNK and ERK.
17603935 2007 Tumor necrosis factor-alpha-induced reactive oxygen species formation is mediated by JNK1-dependent ferritin degradation and elevation of labile iron pool.
17584736 2007 Dissection of a signaling pathway by which pathogen-associated molecular patterns recruit the JNK and p38 MAPKs and trigger cytokine release.
17568996 2007 Dual targeting of IGF-1R and PDGFR inhibits proliferation in high-grade gliomas cells and induces radiosensitivity in JNK-1 expressing cells.
17545598 2007 T-lymphokine-activated killer cell-originated protein kinase functions as a positive regulator of c-Jun-NH2-kinase 1 signaling and H-Ras-induced cell transformation.
17541429 2007 Positive regulation of ASK1-mediated c-Jun NH(2)-terminal kinase signaling pathway by the WD-repeat protein Gemin5.
17496921 2007 Wiring the cell signaling circuitry by the NF-kappa B and JNK1 crosstalk and its applications in human diseases.
17481915 2007 Effect of the alpha3beta1 integrin on the IL-1 stimulated activation of c-Jun N-terminal kinase (JNK) in CACO-2 cells.
17478078 2007 Proinvasive activity of BMP-7 through SMAD4/src-independent and ERK/Rac/JNK-dependent signaling pathways in colon cancer cells.
17453826 Beta-endorphin regulation of MAPKs in cultured human articular chondrocytes: MAPK inhibitors prevent the increase of IL-1 beta protein levels during beta-endorphin stimulation.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17317777 2007 Mitogen-activated protein kinases, inhibitory-kappaB kinase, and insulin signaling in human omental versus subcutaneous adipose tissue in obesity.
17303384 2007 Involvement of MAPKs and NF-kappaB in LPS-induced VCAM-1 expression in human tracheal smooth muscle cells.
17296730 2007 Rev7/MAD2B links c-Jun N-terminal protein kinase pathway signaling to activation of the transcription factor Elk-1.
17255354 2007 The oxidative stress response regulates DKK1 expression through the JNK signaling cascade in multiple myeloma plasma cells.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17178870 2006 Collagen I promotes metastasis in pancreatic cancer by activating c-Jun NH(2)-terminal kinase 1 and up-regulating N-cadherin expression.
17158878 2007 Prostate-derived sterile 20-like kinase 1-alpha induces apoptosis. JNK- and caspase-dependent nuclear localization is a requirement for membrane blebbing.
17079291 2007 Varicella-zoster virus infection of human fibroblast cells activates the c-Jun N-terminal kinase pathway.
17074809 2007 TBP is differentially regulated by c-Jun N-terminal kinase 1 (JNK1) and JNK2 through Elk-1, controlling c-Jun expression and cell proliferation.
17054907 2006 Nitric oxide inhibits an interaction between JNK1 and c-Jun through nitrosylation.
17008315 2006 Activation of STAT3 by G alpha(s) distinctively requires protein kinase A, JNK, and phosphatidylinositol 3-kinase.
16983342 2007 Proteomic identification of C/EBP-DBD multiprotein complex: JNK1 activates stem cell regulator C/EBPalpha by inhibiting its ubiquitination.
16982329 2006 Constitutive c-jun N-terminal kinase activity in acute myeloid leukemia derives from Flt3 and affects survival and proliferation.
16972261 2006 Pharmacologic inhibitors of extracellular signal-regulated kinase (ERKs) and c-Jun NH(2)-terminal kinase (JNK) decrease glutathione content and sensitize human promonocytic leukemia cells to arsenic trioxide-induced apoptosis.
16927023 2006 Activation of mitogen-activated protein kinases is essential for hydrogen peroxide -induced apoptosis in retinal pigment epithelial cells.
16912864 2007 The anti-apoptotic and growth stimulatory actions of leptin in human colon cancer cells involves activation of JNK mitogen activated protein kinase, JAK2 and PI3 kinase/Akt.
16895791 2006 Tumor necrosis factor-alpha down-regulates human Cu/Zn superoxide dismutase 1 promoter via JNK/AP-1 signaling pathway.
16840345 2006 Vaccinia virus B1R kinase interacts with JIP1 and modulates c-Jun-dependent signaling.
16824735 2006 c-JUN N-terminal kinase-1 (JNK1) but not JNK2 or JNK3 is involved in UV signal transduction in human epidermis.
16815888 2006 Identification of a hydrogen peroxide-induced PP1-JNK1-Sp1 signaling pathway for gene regulation.
16814421 2006 Glial cell-derived neurotrophic factor (GDNF) promotes low-grade Hs683 glioma cell migration through JNK, ERK-1/2 and p38 MAPK signaling pathways.
16802349 2006 Regulation of JNK by MKK-7 in fibroblast-like synoviocytes.
16794185 2006 Paclitaxel enhances thrombin-induced endothelial tissue factor expression via c-Jun terminal NH2 kinase activation.
16760468 2006 c-Jun N-terminal kinase is necessary for platelet-derived growth factor-mediated chemotaxis in primary fibroblasts.
16699726 2006 Benzo[a]pyrene-induced cell cycle progression is through ERKs/cyclin D1 pathway and requires the activation of JNKs and p38 mapk in human diploid lung fibroblasts.
16687404 2006 Dynamic positive feedback phosphorylation of mixed lineage kinase 3 by JNK reversibly regulates its distribution to Triton-soluble domains.
16648634 2006 Inhibition of JNK promotes differentiation of epidermal keratinocytes.
16581800 2006 Association and regulation of heat shock transcription factor 4b with both extracellular signal-regulated kinase mitogen-activated protein kinase and dual-specificity tyrosine phosphatase DUSP26.
16569638 2006 Redox-dependent matrix metalloproteinase-1 expression is regulated by JNK through Ets and AP-1 promoter motifs.
16533805 2006 Interacting JNK-docking sites in MKK7 promote binding and activation of JNK mitogen-activated protein kinases.
16465391 2006 Pro-inflammatory signaling by Jun-N-terminal kinase in inflammatory bowel disease.
16434970 2006 Regulation of Nur77 nuclear export by c-Jun N-terminal kinase and Akt.
16412424 2006 Cepharanthine triggers apoptosis in a human hepatocellular carcinoma cell line (HuH-7) through the activation of JNK1/2 and the downregulation of Akt.
16407310 2006 Prostate-derived sterile 20-like kinase 2 (PSK2) regulates apoptotic morphology via C-Jun N-terminal kinase and Rho kinase-1.
16381010 2006 Decreased expression of phosphorylated JNK in breast infiltrating ductal carcinoma is associated with a better overall survival.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16339571 2005 TNFalpha-induced long pentraxin PTX3 expression in human lung epithelial cells via JNK.
16328781 2006 Hyperbaric oxygen induces VEGF expression through ERK, JNK and c-Jun/AP-1 activation in human umbilical vein endothelial cells.
16321971 2006 Helicobacter pylori encoding the pathogenicity island activates matrix metalloproteinase 1 in gastric epithelial cells via JNK and ERK.
16307741 2005 Activation of c-Jun NH2-terminal kinase is required for gemcitabine's cytotoxic effect in human lung cancer H1299 cells.