Property Summary

NCBI Gene PubMed Count 30
PubMed Score 41.91
PubTator Score 20.39

Knowledge Summary

Patent (5,330)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Hyperplasia 26 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma -1.400 2.4e-03
intraductal papillary-mucinous carcinoma... 1.300 3.4e-03
intraductal papillary-mucinous neoplasm ... 2.100 1.9e-03
lung cancer 1.100 4.9e-04
Multiple myeloma 1.311 2.1e-02
osteosarcoma 1.343 4.7e-03
psoriasis 1.300 4.7e-11
tuberculosis -1.100 8.5e-03

Gene RIF (12)

AA Sequence

MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVKHALREIKIIR      1 - 70
RLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLEQGPLLEEHARLFMYQLLRGL     71 - 140
KYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDPHYSHKGHLSEGLVTKWYRSPRLLLSPNNYT    141 - 210
KAIDMWAAGCIFAEMLTGKTLFAGAHELEQMQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQ    211 - 280
LLPGISREALDFLEQILTFSPMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSH    281 - 350
IYNWERYHDCQFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYS    351 - 420
TEPCWQYSDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWKEQSKEKSDKK    421 - 490
GKSKCERNGLVKAQIALEEASQQLAGKEREKNQGFDFDSFIAGTIQLSSQHEPTDVVDKLNDLNSSVSQL    491 - 560
ELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDSQFVSGGEDCFFINQFCEVRKDEQVEKENTYTSYLD    561 - 630
KFFSRKEDTEMLETEPVEDGKLGERGHEEGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPS    631 - 700
AMKSSPQIPHQTYSSILKHLN                                                     701 - 721
//

Text Mined References (40)

PMID Year Title