Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.78
PubTator Score 15.57

Knowledge Summary

Patent (1,710)

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6514 4.8e-64
aldosterone-producing adenoma 646 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Pulmonary immaturity 3 4.45 2.2

Expression

  Differential Expression (2)

Disease log2 FC p
aldosterone-producing adenoma -1.019 1.4e-02
psoriasis -1.900 4.8e-64

Gene RIF (4)

AA Sequence

MAEKGDCIASVYGYDLGGRFVDFQPLGFGVNGLVLSAVDSRACRKVAVKKIALSDARSMKHALREIKIIR      1 - 70
RLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGTLAEEHAKLFMYQLLRGLKYI     71 - 140
HSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYSHKGYLSEGLVTKWYRSPRLLLSPNNYTKAI    141 - 210
DMWAAGCILAEMLTGRMLFAGAHELEQMQLILETIPVIREEDKDELLRVMPSFVSSTWEVKRPLRKLLPE    211 - 280
VNSEAIDFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDIVLMAANQSQLSNW    281 - 350
DTCSSRYPVSLSSDLEWRPDRCQDASEVQRDPRAGSAPLAEDVQVDPRKDSHSSSERFLEQSHSSMERAF    351 - 420
EADYGRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAAGAPPTATGLADTGAREDEPASLF    421 - 490
LEIAQWVKSTQGGPEHASPPADDPERRLSASPPGRPAPVDGGASPQFDLDVFISRALKLCTKPEDLPDNK    491 - 560
LGDLNGACIPEHPGDLVQTEAFSKERW                                               561 - 587
//

Text Mined References (20)

PMID Year Title