Property Summary

NCBI Gene PubMed Count 11
PubMed Score 42.48
PubTator Score 10.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.200 5.0e-04
posterior fossa group A ependymoma 1.800 1.6e-16
astrocytoma 1.700 3.5e-03
atypical teratoid / rhabdoid tumor 1.300 2.6e-05
group 4 medulloblastoma 1.200 1.2e-05
juvenile dermatomyositis 1.067 1.5e-08
acute quadriplegic myopathy 1.568 1.2e-07
Amyotrophic Lateral Sclerosis 1.132 4.5e-07
tuberculosis -1.100 3.4e-07
pediatric high grade glioma 1.100 1.8e-05
pilocytic astrocytoma 1.100 1.1e-06
ovarian cancer 1.900 3.7e-05
dermatomyositis 1.700 1.1e-03

Synonym

Accession Q8NDC0 B2RDD8 Q96BG5
Symbols MISS
C14orf32
c14_5346

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPSGLPPSATPSTVPFGPAPTG      1 - 70
MYPSVPPTGPPPGPPAPFPPSGPSCPPPGGPYPAPTVPGPGPTGPYPTPNMPFPELPRPYGAPTDPAAAG     71 - 140
PLGPWGSMSSGPWAPGMGGQYPTPNMPYPSPGPYPAPPPPQAPGAAPPVPWGTVPPGAWGPPAPYPAPTG    141 - 210
SYPTPGLYPTPSNPFQVPSGPSGAPPMPGGPHSYH                                       211 - 245
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12011110 2002 Meiotic spindle stability depends on MAPK-interacting and spindle-stabilizing protein (MISS), a new MAPK substrate.
8619474 1996 A "double adaptor" method for improved shotgun library construction.