Property Summary

NCBI Gene PubMed Count 21
PubMed Score 29.56
PubTator Score 18.36

Knowledge Summary

Patent (3,796)

TINX Plot

  Disease (3)

Disease Target Count
Bladder Neoplasm 109
Disease Target Count P-value
posterior fossa group B ependymoma 1530 4.8e-10
Disease Target Count Z-score Confidence
Sleeping sickness 37 4.183 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.700 4.8e-10

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (14)

PMID Text
26291129 depletion of endogenous MAPK15 expression inhibited BCR-ABL1-dependent cell proliferation, in vitro
26035356 The present study suggests that MAPK15 overexpression may contribute to the malignant transformation of gastric mucosa by prolonging the stability of c-Jun.
24618899 ERK8 appears as a constitutive brake on N-Acetylgalactosaminyltransferase relocalisation, and the loss of its expression could drive cancer aggressivity through increased cell motility.
23326322 Data suggest that the model coulb be a tool for the development of specific ERK8 kinase inhibitors.
22948227 ATG8-like proteins (MAP1LC3B, GABARAP and GABARAPL1) are novel interactors of MAPK15/ERK8, a MAP kinase involved in cell proliferation and transformation.
21190936 a novel function for ERK8 as a bona fide ERRalpha corepressor, involved in control of its cellular localization by nuclear exclusion, and suggest a key role for this MAP kinase in the regulation of the biological activities of this nuclear receptor.
20733054 Data show that ERK8 prevents HDM2-mediated PCNA destruction by inhibiting the association of PCNA with HDM2, and implicate ERK8 in the regulation of genomic stability.
20395206 Extracellular signal-regulated kinase 8-mediated c-Jun phosphorylation increases tumorigenesis of human colon cancer
19166846 Regulation of the activity and expression of DERK8 by DNA damage are reported.
16624805 human ERK8 has a role as a negative regulator of human GRalpha, acting through Hic-5
16484222 Erk8 has a role as a novel effector of RET/PTC3 and, therefore, RET biological functions
16336213 The activity of ERK8 in transfected HEK-293 cells depends on the relative rates of ERK8 autophosphorylation and dephosphorylation by one or more members of the PPP family of protein serine/threonine phosphatases.
12239168 HIV-1 gp120 binding to CD4 results in activation of the mitogen-activated protein kinase (MAPK) in CD4(+) lymphocytes prestimulated through their T-cell receptor (TCR)
11875070 ERK8, a new member of the mitogen-activated protein kinase family.

AA Sequence

MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDH      1 - 70
PNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKP     71 - 140
SNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGE    141 - 210
MLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDL    211 - 280
LRRLLVFAPDKRLSATQALQHPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILECGGSS    281 - 350
GTSREKGPEGVSPSQAHLHKPRADPQLPSRTPVQGPRPRPQSSPGHDPAEHESPRAAKNVPRQNSAPLLQ    351 - 420
TALLGNGERPPGAKEAPPLTLSLVKPSGRGAAPSLTSQAAAQVANQALIRGDWNRGGGVRVASVQQVPPR    421 - 490
LPPEARPGRRMFSTSALQGAQGGARALLGGYSQAYGTVCHSALGHLPLLEGHHV                    491 - 544
//

Text Mined References (23)

PMID Year Title
26291129 2015 MAPK15 mediates BCR-ABL1-induced autophagy and regulates oncogene-dependent cell proliferation and tumor formation.
26035356 2015 Overexpression of MAPK15 in gastric cancer is associated with copy number gain and contributes to the stability of c-Jun.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
24618899 2014 ERK8 is a negative regulator of O-GalNAc glycosylation and cell migration.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23326322 2013 Structure prediction and validation of the ERK8 kinase domain.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22948227 2012 MAPK15/ERK8 stimulates autophagy by interacting with LC3 and GABARAP proteins.
21531765 2011 High-throughput RNAi screening reveals novel regulators of telomerase.
21190936 2011 Extracellular signal-regulated kinase 8 (ERK8) controls estrogen-related receptor ? (ERR?) cellular localization and inhibits its transcriptional activity.
20733054 2010 A chromatin-bound kinase, ERK8, protects genomic integrity by inhibiting HDM2-mediated degradation of the DNA clamp PCNA.
20395206 2010 Extracellular signal-regulated kinase 8-mediated c-Jun phosphorylation increases tumorigenesis of human colon cancer.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19166846 2009 Regulation of the activity and expression of ERK8 by DNA damage.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16624805 2006 ERK8 down-regulates transactivation of the glucocorticoid receptor through Hic-5.
16484222 2006 Activation of the Erk8 mitogen-activated protein (MAP) kinase by RET/PTC3, a constitutively active form of the RET proto-oncogene.
16336213 2006 Characterization of the reversible phosphorylation and activation of ERK8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875070 2002 ERK8, a new member of the mitogen-activated protein kinase family.