Property Summary

Ligand Count 1,321
NCBI Gene PubMed Count 1,100
PubMed Score 2240.80
PubTator Score 4467.32

Knowledge Summary

Patent (302,082)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.400 5.2e-03
Astrocytoma, Pilocytic -1.200 1.0e-03
atypical teratoid / rhabdoid tumor -1.700 1.5e-06
axial spondyloarthropathy 1.100 4.4e-02
ependymoma -1.500 1.2e-08
Gaucher disease type 1 -1.200 1.3e-02
glioblastoma -1.100 1.4e-04
group 3 medulloblastoma 1.100 8.0e-03
lung cancer 1.800 1.2e-03
medulloblastoma, large-cell -1.100 1.0e-04
osteosarcoma -1.745 5.1e-06
ovarian cancer -1.600 6.5e-12
pancreatic ductal adenocarcinoma liver m... -1.010 1.9e-02
progressive supranuclear palsy 1.300 1.0e-02
psoriasis 1.300 9.0e-08
subependymal giant cell astrocytoma -1.659 7.8e-03
Waldenstrons macroglobulinemia 1.128 1.4e-02

Synonym

Accession Q16539 A6ZJ92 A8K6P4 B0LPH0 B5TY32 O60776 Q13083 Q14084 Q8TDX0 MAP kinase 14
Symbols RK
p38
CSBP
EXIP
Mxi2
CSBP1
CSBP2
CSPB1
PRKM14
PRKM15
SAPK2A
p38ALPHA

Gene

PDB

2OKR   2ONL   2Y8O   5ETF   1A9U   1BL6   1BL7   1BMK   1DI9   1IAN   1KV1   1KV2   1M7Q   1OUK   1OUY   1OVE   1OZ1   1R39   1R3C   1W7H   1W82   1W83   1W84   1WBN   1WBO   1WBS   1WBT   1WBV   1WBW   1WFC   1YQJ   1ZYJ   1ZZ2   1ZZL   2BAJ   2BAK   2BAL   2BAQ   2FSL   2FSM   2FSO   2FST   2GFS   2I0H   2LGC   2NPQ   2QD9   2RG5   2RG6   2YIS   2YIW   2YIX   2ZAZ   2ZB0   2ZB1   3BV2   3BV3   3BX5   3C5U   3CTQ   3D7Z   3D83   3DS6   3DT1   3E92   3E93   3FC1   3FI4   3FKL   3FKN   3FKO   3FL4   3FLN   3FLQ   3FLS   3FLW   3FLY   3FLZ   3FMH   3FMJ   3FMK   3FML   3FMM   3FMN   3FSF   3FSK   3GC7   3GCP   3GCQ   3GCS   3GCU   3GCV   3GFE   3GI3   3HA8   3HEC   3HEG   3HL7   3HLL   3HP2   3HP5   3HRB   3HUB   3HUC   3HV3   3HV4   3HV5   3HV6   3HV7   3HVC   3IPH   3ITZ   3IW5   3IW6   3IW7   3IW8   3K3I   3K3J   3KF7   3KQ7   3L8S   3L8X   3LFA   3LFB   3LFC   3LFD   3LFE   3LFF   3LHJ   3MGY   3MH0   3MH1   3MH2   3MH3   3MPA   3MPT   3MVL   3MVM   3MW1   3NEW   3NNU   3NNV   3NNW   3NNX   3NWW   3O8P   3O8T   3O8U   3OBG   3OBJ   3OC1   3OCG   3OD6   3ODY   3ODZ   3OEF   3PG3   3QUD   3QUE   3RIN   3ROC   3S3I   3S4Q   3U8W   3UVP   3UVQ   3UVR   3ZS5   3ZSG   3ZSH   3ZSI   3ZYA   4A9Y   4AA0   4AA4   4AA5   4AAC   4DLI   4DLJ   4E5A   4E5B   4E6A   4E6C   4E8A   4EH2   4EH3   4EH4   4EH5   4EH6   4EH7   4EH8   4EH9   4EHV   4EWQ   4F9W   4F9Y   4FA2   4GEO   4KIN   4KIP   4KIQ   4L8M   4R3C   4ZTH   5ETA   5ETC   5ETI   5ML5   5MTX   5MTY   5N63   5N64   5N65   5N66   5N67   5N68   5O8U   5O8V   5TBE   5TCO  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (996)

AA Sequence

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYR      1 - 70
ELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKY     71 - 140
IHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG    141 - 210
CIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPL    211 - 280
AVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVP    281 - 350
PPLDQEEMES                                                                351 - 360
//

Text Mined References (1138)

PMID Year Title