Property Summary

NCBI Gene PubMed Count 1,029
PubMed Score 2109.93
PubTator Score 4467.32

Knowledge Summary

Patent (302,082)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 7.6477274599166E-9
psoriasis 6685 9.02905705434981E-8
glioblastoma 5572 1.1591146781881E-6
atypical teratoid / rhabdoid tumor 4369 1.45532491755904E-6
ovarian cancer 8492 2.32341889975981E-6
osteosarcoma 7933 5.14653233647883E-6
lung cancer 4473 2.94035339478522E-5
pediatric high grade glioma 2712 1.0033399406707E-4
medulloblastoma, large-cell 6234 4.91831801753689E-4
pilocytic astrocytoma 3086 6.68347110991644E-4
group 4 medulloblastoma 1875 0.00122347457645824
subependymal giant cell astrocytoma 2287 0.00778724225303235
progressive supranuclear palsy 674 0.0102812286321136
Gaucher disease type 1 171 0.0124812621361031
Waldenstrons macroglobulinemia 765 0.0135809793145851
pancreatic ductal adenocarcinoma liver metastasis 1795 0.019489404739811
axial spondyloarthropathy 28 0.0436381926826045

Expression

Synonym

Accession Q16539 A6ZJ92 A8K6P4 B0LPH0 B5TY32 O60776 Q13083 Q14084 Q8TDX0 MAP kinase 14
Symbols RK
p38
CSBP
EXIP
Mxi2
CSBP1
CSBP2
CSPB1
PRKM14
PRKM15
SAPK2A
p38ALPHA

Gene

PDB

2OKR   2ONL   2Y8O   1A9U   1BL6   1BL7   1BMK   1DI9   1IAN   1KV1   1KV2   1M7Q   1OUK   1OUY   1OVE   1OZ1   1R39   1R3C   1W7H   1W82   1W83   1W84   1WBN   1WBO   1WBS   1WBT   1WBV   1WBW   1WFC   1YQJ   1ZYJ   1ZZ2   1ZZL   2BAJ   2BAK   2BAL   2BAQ   2FSL   2FSM   2FSO   2FST   2GFS   2I0H   2LGC   2NPQ   2QD9   2RG5   2RG6   2YIS   2YIW   2YIX   2ZAZ   2ZB0   2ZB1   3BV2   3BV3   3BX5   3C5U   3CTQ   3D7Z   3D83   3DS6   3DT1   3E92   3E93   3FC1   3FI4   3FKL   3FKN   3FKO   3FL4   3FLN   3FLQ   3FLS   3FLW   3FLY   3FLZ   3FMH   3FMJ   3FMK   3FML   3FMM   3FMN   3FSF   3FSK   3GC7   3GCP   3GCQ   3GCS   3GCU   3GCV   3GFE   3GI3   3HA8   3HEC   3HEG   3HL7   3HLL   3HP2   3HP5   3HRB   3HUB   3HUC   3HV3   3HV4   3HV5   3HV6   3HV7   3HVC   3IPH   3ITZ   3IW5   3IW6   3IW7   3IW8   3K3I   3K3J   3KF7   3KQ7   3L8S   3L8X   3LFA   3LFB   3LFC   3LFD   3LFE   3LFF   3LHJ   3MGY   3MH0   3MH1   3MH2   3MH3   3MPA   3MPT   3MVL   3MVM   3MW1   3NEW   3NNU   3NNV   3NNW   3NNX   3NWW   3O8P   3O8T   3O8U   3OBG   3OBJ   3OC1   3OCG   3OD6   3ODY   3ODZ   3OEF   3PG3   3QUD   3QUE   3RIN   3ROC   3S3I   3S4Q   3U8W   3UVP   3UVQ   3UVR   3ZS5   3ZSG   3ZSH   3ZSI   3ZYA   4A9Y   4AA0   4AA4   4AA5   4AAC   4DLI   4DLJ   4E5A   4E5B   4E6A   4E6C   4E8A   4EH2   4EH3   4EH4   4EH5   4EH6   4EH7   4EH8   4EH9   4EHV   4EWQ   4F9W   4F9Y   4FA2   4GEO   4KIN   4KIP   4KIQ   4L8M   4R3C   4ZTH   5ETC   5ETI  

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
1358 screening 11 / 0 / 0 Determination of inhibition of thapsigargin-initiated p38 MAPK activation in ER stress signaling.
1387 other 2 / 0 / 0 Determination of dose dependent inhibition of thapsigargin-initiated p38 MAPK activation in ER stress signaling using immunoblotting
1391 other 2 / 0 / 0 Determination of dose dependent inhibition of thapsigargin-initiated p38 MAPK activation in ER stress signaling using MSD ELISA
1395 summary 1 / 0 / 0 Chemical Inhibitors of ER Stress
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588615 other 0 / 0 / 3 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of P38 protein levels in DLD1 cells
588616 other 3 / 0 / 0 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of phospho-P38 protein levels in DLD1 cells
588640 other 2 / 0 / 1 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of P38 protein levels in HCT116 human colorectal carcinoma cells
588646 other 2 / 0 / 1 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of phosphorylated P38 protein levels in HCT116 human colorectal carcinoma cells
588658 other 3 / 0 / 0 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of phosphorylated P38 protein levels in HT29 human colorectal carcinoma cells
More...

Gene RIF (924)

PMID Text
27098723 the purpose of this paper was to investigate MAPK downstream signalling molecules in Natural killer cell phenotypes from Chronic Fatigue Syndrome/Myalgic Encephalomyelitis patients.
26988982 These results indicate that IL-17A enhances COX2 expression and PGE2 production via the p38/c-Fos and JNK/c-Jun signalling pathways in NP cells to mediate intervertebral disc inflammation.
26884859 IVIG inhibits TNF-alpha-induced MMP9 expression and activity in monocytes by suppressing NF-kappaB and P38 MAPK activation, preventing monocyte migration.
26825960 Specific inhibition of BRAF oncogene, MEK or p38 signaling was associated with decreases in DIO3 expression in papillary thyroid cancer cells
26823708 Portulacerebroside A stimulates apoptosis of HL60 cells by down-regulating p38/JNK signaling pathway.
26742425 Taken together, our data show that enhanced expression of endothelial TF, which plays an important role in coagulopathy and splenic vein remodeling in liver cirrhosis, is induced by IL-17A in a ROS dependent manner.
26714046 Expression of GALNT3 was reduced in CAD patients, and down regulation of GALNT3 contributed to endothelial injury by promoting apoptosis and up-regulating the expression of MMP-2 and MMP-14 genes via p38 MAPK activation.
26663083 p38alpha MAPK plays a critical role in the regulation of BACE1 degradation and Abeta generation in Alzheimer Disease pathogenesis
26621504 In conclusion, rheumatoid arthritis synovial fibroblasts were activated by CXCL16 to produce RANKL via pathways involving JAK2/STAT3 and p38/MAPK
26616734 a linear p38-MK2-14-3-3 signalling pathway that specifically targets CEP131 to trigger centriolar satellite remodelling after cell stress.
More...

AA Sequence

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYR      1 - 70
ELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKY     71 - 140
IHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG    141 - 210
CIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPL    211 - 280
AVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVP    281 - 350
PPLDQEEMES                                                                351 - 360
//

Text Mined References (1066)

PMID Year Title
27098723 2016 ERK1/2, MEK1/2 and p38 downstream signalling molecules impaired in CD56 dim CD16+ and CD56 bright CD16 dim/- natural killer cells in Chronic Fatigue Syndrome/Myalgic Encephalomyelitis patients.
26988982 2016 IL-17 mediates inflammatory reactions via p38/c-Fos and JNK/c-Jun activation in an AP-1-dependent manner in human nucleus pulposus cells.
26884859 2015 IVIG inhibits TNF-?-induced MMP9 expression and activity in monocytes by suppressing NF-?B and P38 MAPK activation.
26825960 2016 MAPK and SHH pathways modulate type 3 deiodinase expression in papillary thyroid carcinoma.
26823708 2015 Effects of portulacerebroside a on apoptosis of human leukemia HL60 cells and p38/JNK signaling pathway.
26742425 2016 IL-17A up-regulates expression of endothelial tissue factor in liver cirrhosis via the ROS/p38 signal pathway.
26714046 2016 Down regulation of GALNT3 contributes to endothelial cell injury via activation of p38 MAPK signaling pathway.
26663083 2016 Deficiency of Neuronal p38? MAPK Attenuates Amyloid Pathology in Alzheimer Disease Mouse and Cell Models through Facilitating Lysosomal Degradation of BACE1.
26621504 2016 CXCL16 upregulates RANKL expression in rheumatoid arthritis synovial fibroblasts through the JAK2/STAT3 and p38/MAPK signaling pathway.
26616734 2015 p38- and MK2-dependent signalling promotes stress-induced centriolar satellite remodelling via 14-3-3-dependent sequestration of CEP131/AZI1.
More...