Property Summary

Ligand Count 1,345
NCBI Gene PubMed Count 1,100
PubMed Score 2240.80
PubTator Score 4467.32

Knowledge Summary

Patent (302,082)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.400 5.2e-03
Astrocytoma, Pilocytic -1.200 1.0e-03
atypical teratoid / rhabdoid tumor -1.700 1.5e-06
axial spondyloarthropathy 1.100 4.4e-02
ependymoma -1.500 1.2e-08
Gaucher disease type 1 -1.200 1.3e-02
glioblastoma -1.100 1.4e-04
group 3 medulloblastoma 1.100 8.0e-03
lung cancer 1.800 1.2e-03
medulloblastoma, large-cell -1.100 1.0e-04
osteosarcoma -1.745 5.1e-06
ovarian cancer -1.600 6.5e-12
pancreatic ductal adenocarcinoma liver m... -1.010 1.9e-02
progressive supranuclear palsy 1.300 1.0e-02
psoriasis 1.300 9.0e-08
subependymal giant cell astrocytoma -1.659 7.8e-03
Waldenstrons macroglobulinemia 1.128 1.4e-02

PDB (220)

Gene RIF (996)

AA Sequence

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYR      1 - 70
ELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKY     71 - 140
IHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG    141 - 210
CIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPL    211 - 280
AVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVP    281 - 350
PPLDQEEMES                                                                351 - 360
//

Text Mined References (1138)

PMID Year Title