Property Summary

NCBI Gene PubMed Count 53
PubMed Score 317.10
PubTator Score 33.36

Knowledge Summary

Patent (6,900)

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.219 1.0e-02
adrenocortical carcinoma -1.469 6.3e-03
intraductal papillary-mucinous adenoma (... 1.200 5.2e-04
lung cancer 2.000 1.1e-03
breast carcinoma 1.100 1.7e-04
interstitial cystitis -1.200 2.6e-03
psoriasis 1.300 1.9e-11
ductal carcinoma in situ 1.800 2.5e-04
invasive ductal carcinoma 2.300 9.7e-04

Protein-protein Interaction (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (33)

PMID Text
26969274 MAPK13 gene knockdown using siRNA reduced the aldehyde dehydrogenase high cell population and abrogated the tumor-initiating ability.
26843485 p38gamma and p38delta reprogram liver metabolism by modulating neutrophil infiltration and provide a potential target for NAFLD therapy
26270987 p38-MAPK13 (delta isoform of p38-MAPK) is involved in Vpr-mediated IL6 induction in astrocytes
26075907 p38-MAPK13 (delta isoform of p38-MAPK) is involved in Vpr-mediated IL6 induction in astrocytes
25849390 MAPK13 undergoes a larger interlobe configurational rearrangement upon activation compared with MAPK14.
24658403 p38-MAPK13 (delta isoform of p38-MAPK) is involved in Vpr-mediated IL6 induction in astrocytes
24599959 PKCdelta activates a MEKK1/MEK3/p38delta MAPK cascade to increase p53 levels and p53 drives p21(Cip1) gene expression.
24447338 p38-MAPK13 (delta isoform of p38-MAPK) is involved in Vpr-mediated IL6 induction in astrocytes
24244375 p38-MAPK13 (delta isoform of p38-MAPK) is involved in Vpr-mediated IL6 induction in astrocytes
24225433 p38-MAPK13 (delta isoform of p38-MAPK) is involved in Vpr-mediated IL6 induction in astrocytes
23878395 Data indicate that p38delta mediates oncogene-induced senescence through a p53- and p16(INK4A)-independent mechanism.
23798682 GSK3alpha, GSK3beta, and MAPK13 were found to be the most active tau kinases, phosphorylating tau at all four epitopes.
23722928 esophageal squamous cell carcinoma cell lines which are p38delta-negative grew more quickly than cell lines which express endogenous p38delta.
23590314 DNA methylation alterations are widespread in melanoma; epigenetic silencing of MAPK13 contributes to melanoma progression
23187130 MAPK13 is responsible for IL-13-driven mucus production in human airway epithelial cells.
22730327 SEPW1 silencing increases MKK4, which activates p38gamma, p38delta, and JNK2 to phosphorylate p53 on Ser-33 and cause a transient G(1) arrest.
22199349 PRMT5 inhibits the PKCdelta- or 12-O-tetradecanoylphorbol-13-acetate-dependent increase in human involucrin expression, and PRMT5 dimethylates proteins in the p38delta complex.
20805296 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20804750 Isoforms of p38MAPK gamma and delta contribute to differentiation of human AML cells induced by 1,25-dihydroxyvitamin D.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20478268 Taken together, the data indicate that the respective stress-dependent action of p38 isoforms is responsible for the up-regulation of the gene expression of the chemokine BRAK/CXCL14.
20090411 Function of p38delta in regulating of epidermal keratinocyte differentiation, apoptosis and skin tumor development, is discussed.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19816939 results indicate that p38delta is important for motility and invasion of CC cells, suggesting that p38delta may play an important role in CC metastasis.
18559936 These results suggest that, in SupT1-based cell lines, p38alpha, p38gamma and p38delta, but not p38beta, are implicated in both HIV-1 induced replication and apoptosis in infected and uninfected bystander cells.
18367666 activation of p38 isoforms by hypertonicity does not contribute to activation of TonEBP/OREBP because of opposing effects of p38alpha and p38delta.
16644870 sapk4 activation mediates apoptosis and neurodegeneration in infantile neuronal ceroid lipofuscinosis
15340077 p38delta mitogen-activated protein kinase as a downstream carrier of the PKCdelta-dependent death signal in keratinocytes
12810719 observations suggest that p38 delta is the major p38 isoform driving suprabasal hINV gene expression and that p38 delta directly regulates ERK1/2 activity via formation of a p38 delta-ERK1/2 complex
12482858 p38 has a role in mediating induction of VEGF mRNA expression by sodium arsenite
12239168 p38-MAPK13 (delta isoform of p38-MAPK) is involved in Vpr-mediated IL6 induction in astrocytes
12080077 Novel protein kinase C isoforms regulate human keratinocyte differentiation by activating a p38 delta mitogen-activated protein kinase cascade that targets CCAAT/enhancer-binding protein alpha

AA Sequence

MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAY      1 - 70
RELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKY     71 - 140
IHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVG    141 - 210
CIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQ    211 - 280
AADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFS    281 - 350
PIARKDSRRRSGMKL                                                           351 - 365
//

Text Mined References (63)

PMID Year Title
26969274 2016 MAPK13 is preferentially expressed in gynecological cancer stem cells and has a role in the tumor-initiation.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26843485 2016 p38? and p38? reprogram liver metabolism by modulating neutrophil infiltration.
25849390 2015 The crystal structure of phosphorylated MAPK13 reveals common structural features and differences in p38 MAPK family activation.
24599959 2014 p38? regulates p53 to control p21Cip1 expression in human epidermal keratinocytes.
23878395 2013 Induction of p38? expression plays an essential role in oncogenic ras-induced senescence.
23798682 2013 An unbiased approach to identifying tau kinases that phosphorylate tau at sites associated with Alzheimer disease.
23722928 2013 Loss of p38? mitogen-activated protein kinase expression promotes oesophageal squamous cell carcinoma proliferation, migration and anchorage-independent growth.
23590314 2013 Genome-wide promoter methylation analysis identifies epigenetic silencing of MAPK13 in primary cutaneous melanoma.
23187130 2012 IL-13-induced airway mucus production is attenuated by MAPK13 inhibition.
22730327 2012 Delayed cell cycle progression in selenoprotein W-depleted cells is regulated by a mitogen-activated protein kinase kinase 4-p38/c-Jun NH2-terminal kinase-p53 pathway.
22447027 2012 Bidirectional regulation of neutrophil migration by mitogen-activated protein kinases.
22199349 2012 Protein arginine methyltransferase 5 (PRMT5) signaling suppresses protein kinase C?- and p38?-dependent signaling and keratinocyte differentiation.
21269460 2011 Initial characterization of the human central proteome.
20805296 2011 Genetic variants within the MAP kinase signalling network and anti-TNF treatment response in rheumatoid arthritis patients.
20804750 2011 Isoforms of p38MAPK gamma and delta contribute to differentiation of human AML cells induced by 1,25-dihydroxyvitamin D?.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20626350 2010 Mechanisms and functions of p38 MAPK signalling.
20478268 2010 Human p38 delta MAP kinase mediates UV irradiation induced up-regulation of the gene expression of chemokine BRAK/CXCL14.
20090411 2010 p38delta mitogen-activated protein kinase regulates skin homeostasis and tumorigenesis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19816939 2010 p38delta/MAPK13 as a diagnostic marker for cholangiocarcinoma and its involvement in cell motility and invasion.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19279008 2009 Acid beta-glucosidase 1 counteracts p38delta-dependent induction of interleukin-6: possible role for ceramide as an anti-inflammatory lipid.
19135240 2009 Regulation of PKD by the MAPK p38delta in insulin secretion and glucose homeostasis.
18559936 2008 Implication of p38 mitogen-activated protein kinase isoforms (alpha, beta, gamma and delta) in CD4+ T-cell infection with human immunodeficiency virus type I.
18367666 2008 MKP-1 inhibits high NaCl-induced activation of p38 but does not inhibit the activation of TonEBP/OREBP: opposite roles of p38alpha and p38delta.
18088087 2008 Phosphoproteome of resting human platelets.
18006338 p38MAPK delta controls c-Myb degradation in response to stress.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17256148 2007 Activation of PKCdelta and p38delta MAPK during okadaic acid dependent keratinocyte apoptosis.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16644870 2006 Endoplasmic reticulum stress-induced caspase-4 activation mediates apoptosis and neurodegeneration in INCL.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15850461 2005 The phosphorylation of CapZ-interacting protein (CapZIP) by stress-activated protein kinases triggers its dissociation from CapZ.
15632108 2005 Evidence that phosphorylation of the microtubule-associated protein Tau by SAPK4/p38delta at Thr50 promotes microtubule assembly.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340077 2004 Protein kinase Cdelta regulates keratinocyte death and survival by regulating activity and subcellular localization of a p38delta-extracellular signal-regulated kinase 1/2 complex.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12810719 2003 A regulatory role for p38 delta MAPK in keratinocyte differentiation. Evidence for p38 delta-ERK1/2 complex formation.
12482858 2003 Evidence for a role of p38 kinase in hypoxia-inducible factor 1-independent induction of vascular endothelial growth factor expression by sodium arsenite.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12244047 2002 Fibroblast growth factor homologous factors and the islet brain-2 scaffold protein regulate activation of a stress-activated protein kinase.
12171600 2002 Stress-induced regulation of eukaryotic elongation factor 2 kinase by SB 203580-sensitive and -insensitive pathways.
12080077 2002 Novel protein kinase C isoforms regulate human keratinocyte differentiation by activating a p38 delta mitogen-activated protein kinase cascade that targets CCAAT/enhancer-binding protein alpha.
11943212 2002 Phosphorylation of microtubule-associated protein tau by stress-activated protein kinases in intact cells.
11520933 2001 Nerve growth factor signaling, neuroprotection, and neural repair.
11500363 2001 A novel method to identify protein kinase substrates: eEF2 kinase is phosphorylated and inhibited by SAPK4/p38delta.
11378392 2001 Fibroblast growth factor homologous factors are intracellular signaling proteins.
10727080 1999 Structure and polymorphism of two stress-activated protein kinase genes centromeric of the MHC: SAPK2a and SAPK4.
10201954 1999 Differential expression and activation of p38 mitogen-activated protein kinase alpha, beta, gamma, and delta in inflammatory cell lineages.
10066767 1999 Murine p38-delta mitogen-activated protein kinase, a developmentally regulated protein kinase that is activated by stress and proinflammatory cytokines.
9841871 1998 Human mitogen-activated protein kinase kinase kinase mediates the stress-induced activation of mitogen-activated protein kinase cascades.
9731215 1998 Identification of stathmin as a novel substrate for p38 delta.
9628874 1998 PRAK, a novel protein kinase regulated by the p38 MAP kinase.
9374491 1997 Characterization of the structure and function of the fourth member of p38 group mitogen-activated protein kinases, p38delta.
9297626 1997 Ras effectors and their role in mitogenesis and oncogenesis.
9295308 1997 Molecular cloning and characterization of a novel p38 mitogen-activated protein kinase.
9218798 1997 Activation of the novel stress-activated protein kinase SAPK4 by cytokines and cellular stresses is mediated by SKK3 (MKK6); comparison of its substrate specificity with that of other SAP kinases.
9207191 1997 Novel homologues of CSBP/p38 MAP kinase: activation, substrate specificity and sensitivity to inhibition by pyridinyl imidazoles.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.