Property Summary

Ligand Count 40
NCBI Gene PubMed Count 95
PubMed Score 98.56
PubTator Score 91.90

Knowledge Summary

Patent (10,104)

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 1.4e-03
Astrocytoma, Pilocytic -1.200 5.0e-05
atypical teratoid / rhabdoid tumor -2.000 6.3e-06
glioblastoma -1.700 2.7e-05
medulloblastoma -1.200 7.3e-04
medulloblastoma, large-cell -2.300 1.1e-04
posterior fossa group A ependymoma -1.100 2.1e-05

Protein-protein Interaction (5)

Gene RIF (40)

AA Sequence

MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYR      1 - 70
ELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKY     71 - 140
IHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG    141 - 210
CIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPL    211 - 280
AIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKP    281 - 350
PEPPKPPGSLEIEQ                                                            351 - 364
//

Text Mined References (99)

PMID Year Title