Property Summary

NCBI Gene PubMed Count 93
PubMed Score 96.91
PubTator Score 91.90

Knowledge Summary

Patent (10,104)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.000 6.3e-06
glioblastoma -1.700 2.7e-05
medulloblastoma -1.200 7.3e-04
medulloblastoma, large-cell -2.300 1.1e-04
pediatric high grade glioma -1.300 4.4e-05
pilocytic astrocytoma -1.200 9.4e-05
posterior fossa group A ependymoma -1.100 2.1e-05

 GO Component (2)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (38)

PMID Text
27029009 Suggest that R-Ras regulates angiogenic activities of endothelial cells in part via inhibition of the p38MAPK-HSP27 axis of VEGF signaling.
26270987 HIV-1 Vpr-mediated upregulation of CXCL8 (IL8) involves p38-MAPK11 (beta isoform of p38-MAPK) in astrocytes
26075907 HIV-1 Vpr-mediated upregulation of CXCL8 (IL8) involves p38-MAPK11 (beta isoform of p38-MAPK) in astrocytes
25936522 These findings suggest that coronin 1A modulates endothelial cell apoptosis by regulating p38beta expression and activation.
25918994 The MAPK11 gene was variably methylated in monozygotic twins discordant for depressive disorder.
25066918 Data show that the p38 MAPK (p38) isoform (p38beta) mitogen-activated protein kinase 11 (MAPK11) is expressed in breast cancer cell.
25006254 study identified the structural motif responsible for the unique autophosphorylation capability of p38beta and the motif inhibiting this activity in living cells
24673557 Differential roles for p38alpha and p38beta in the HGF-induced expression of key osteogenic markers.
23807508 p38beta is a novel regulatory target of the transcription factor Pokemon and positively regulated by Pokemon in hepatic cells.
23625915 inhibition of the SOCE downstream target CaM kinase kinase beta (CaMKKbeta) or knockdown of AMPKalpha1 suppressed PAR-1-mediated phosphorylation of p38beta and hence STIM1.
23435415 Study identifies Hsp27 as a novel target of ILK-p38beta signaling complexes, playing a key role in bladder cancer cell migration.
22522454 Thus, in endothelial cells p38alpha mediates apoptotic signaling, whereas p38beta and p38gamma transduce survival signaling
22157753 Overexpression of p38beta or Rac1 significantly enhanced (1.9- and 3.9-fold, respectively), the tRA-stimulated NIS expression in MCF-7 cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20378550 p38alpha/p38beta and phosphoinositide 3-kinase are crucial to Tat-induced IL-10 production
20378550 HIV-1 Vpr-mediated upregulation of CXCL8 (IL8) involves p38-MAPK11 (beta isoform of p38-MAPK) in astrocytes
20188673 show that p38 MAP kinase directly activates TACE and effects shedding in response to growth factors and Erk MAP kinase activation.
20162623 These results demonstrate that activin A induces erythroid differentiation of K562 cells through activation of MKK6-p38alpha/p38beta pathway and follistatin inhibits those effects.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20053787 results demonstrate that IFN-alpha can regulate growth inhibition of Jurkat cells through p38alpha and p38beta
19913121 Observational study of gene-disease association. (HuGE Navigator)
19706373 Specific isoforms of p38 and their sub-cellular localization may have different roles in modulating ischemic injury.
19082897 genistein protects human vascular endothelial cells against tumor necrosis factor-alpha-induced apoptosis through the p38beta mitogen-activated protein kinase
18950637 The authors characterized the multisite phosphorylation of the ATF7 activation domain and identified one of the involved kinase, p38beta2 mitogen-activated protein kinase.
16643845 p38 phosphorylation occurred in response to attack by Staphylococcus aureus alpha-toxin and streptolysin O, commencing within minutes after toxin treatment and waning after several hours.
15708845 p38alpha and -beta mediate UV-induced, AP-1-mediated, c-Fos phosphorylation
15326477 p38SAPK might be involved in the regulation of cyclin D3 levels and suggest that this mechanism is involved in the maturation of precursor T-cells
15304097 cholesterol depletion alters involucrin gene expression through activation of p38alpha/beta.
15273249 SAPK2/p38 mitogen-activated protein kinase is inhibited by PML in tumor cells
15249224 These results suggest that bFGF can negatively modulate p38 and positively modulate ERK1/2 to antagonize activin A-mediated growth inhibition and Hb synthesis in K562 cells.
14724572 phosphorylation of Y1214 on VEGFR2 is required to trigger the sequential activation of Cdc42 and SAPK2/p38 and to drive the SAPK2/p38-mediated actin remodeling in stress fibers in endothelial cells exposed to VEGF
14688370 SAPK2/p38 intervenes in the control of MonoMac6 cell migration induced by monocyte chemoattractant protein-1.
14651992 Activities of aPKC (P<0.05) and ERK 1/2 (P=0.06), but not phosphorylation of P38 MAPK, were higher in trained than in sedentary subjects at rest.
14522966 activation of p38 MAPK is involved in the mitochondrial activation-mediated cell death pathway
12586546 Neurotoxicity of pneumolysin depends on activation of p38 mitogen-activated protein kinase.
12510156 the p38MAPK activation-Bax expression pathway might be involved in apoptosis induced by oxidative stress
12384504 p38 MAP Kinase suppresses the function of Mirk as a transcriptional activator only when cells are proliferating
12239168 HIV-1 Vpr-mediated upregulation of CXCL8 (IL8) involves p38-MAPK11 (beta isoform of p38-MAPK) in astrocytes

AA Sequence

MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYR      1 - 70
ELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKY     71 - 140
IHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG    141 - 210
CIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPL    211 - 280
AIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKP    281 - 350
PEPPKPPGSLEIEQ                                                            351 - 364
//

Text Mined References (97)

PMID Year Title
27029009 2015 R-Ras Inhibits VEGF-Induced p38MAPK Activation and HSP27 Phosphorylation in Endothelial Cells.
25936522 2015 Coronin 1A depletion protects endothelial cells from TNF?-induced apoptosis by modulating p38? expression and activation.
25918994 2015 Genome-wide methylation study on depression: differential methylation and variable methylation in monozygotic twins.
25754930 2015 Up-regulation of galectin-9 induces cell migration in human dendritic cells infected with dengue virus.
25066918 2014 MAPK11 in breast cancer cells enhances osteoclastogenesis and bone resorption.
25006254 2014 The p38? mitogen-activated protein kinase possesses an intrinsic autophosphorylation activity, generated by a short region composed of the ?-G helix and MAPK insert.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24673557 2014 Hepatocyte growth factor and p38 promote osteogenic differentiation of human mesenchymal stem cells.
23807508 2013 p38?, A novel regulatory target of Pokemon in hepatic cells.
23625915 2013 Store-operated Ca2+ entry (SOCE) induced by protease-activated receptor-1 mediates STIM1 protein phosphorylation to inhibit SOCE in endothelial cells through AMP-activated protein kinase and p38? mitogen-activated protein kinase.
23483889 2013 Protein arginine methyltransferase 1 interacts with and activates p38? to facilitate erythroid differentiation.
23435415 2014 Selective regulation of p38? protein and signaling by integrin-linked kinase mediates bladder cancer cell migration.
22522454 2012 TGF-?1 induces endothelial cell apoptosis by shifting VEGF activation of p38(MAPK) from the prosurvival p38? to proapoptotic p38?.
22515544 2012 p38? MAP kinase as a therapeutic target for pancreatic cancer.
22157753 2012 Regulation of sodium iodide symporter gene expression by Rac1/p38? mitogen-activated protein kinase signaling pathway in MCF-7 breast cancer cells.
21911485 2011 Inhibition of SAPK2/p38 enhances sensitivity to mTORC1 inhibition by blocking IRES-mediated translation initiation in glioblastoma.
21757713 2011 Phosphorylation of Raptor by p38beta participates in arsenite-induced mammalian target of rapamycin complex 1 (mTORC1) activation.
20724307 2011 Oestrogen prevents cardiomyocyte apoptosis by suppressing p38?-mediated activation of p53 and by down-regulating p53 inhibition on p38?.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20626350 2010 Mechanisms and functions of p38 MAPK signalling.
20378550 2010 Differential induction of interleukin-10 in monocytes by HIV-1 clade B and clade C Tat proteins.
20188673 2010 Direct activation of TACE-mediated ectodomain shedding by p38 MAP kinase regulates EGF receptor-dependent cell proliferation.
20162623 2010 Activin A induction of erythroid differentiation through MKK6-p38alpha/p38beta pathway is inhibited by follistatin.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20053787 2010 Interferon-alpha induces the growth inhibition of human T-cell leukaemia line Jurkat through p38alpha and p38beta.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19706373 2009 Effect of p38 MAP kinases on contractility and ischemic injury in intact heart.
19622861 2009 The three-dimensional structure of MAP kinase p38beta: different features of the ATP-binding site in p38beta compared with p38alpha.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19082897 2009 Isoflavone genistein protects human vascular endothelial cells against tumor necrosis factor-alpha-induced apoptosis through the p38beta mitogen-activated protein kinase.
18950637 2008 p38beta2-mediated phosphorylation and sumoylation of ATF7 are mutually exclusive.
18192325 2008 Transforming growth factor-beta-induced alpha-smooth muscle cell actin expression in renal proximal tubular cells is regulated by p38beta mitogen-activated protein kinase, extracellular signal-regulated protein kinase1,2 and the Smad signalling during epithelial-myofibroblast transdifferentiation.
17380123 2007 A new p38 MAP kinase-regulated transcriptional coactivator that stimulates p53-dependent apoptosis.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17254968 2007 PRAK is essential for ras-induced senescence and tumor suppression.
17241234 2007 Intrinsically active variants of all human p38 isoforms.
16966330 2006 Phosphorylation of Tyr1214 within VEGFR-2 triggers the recruitment of Nck and activation of Fyn leading to SAPK2/p38 activation and endothelial cell migration in response to VEGF.
16643845 2006 Differential role of p38 mitogen activated protein kinase for cellular recovery from attack by pore-forming S. aureus alpha-toxin or streptolysin O.
16341674 2005 Transcriptome analysis of human gastric cancer.
16120828 2005 Epidermal growth factor stimulation of trophoblast differentiation requires MAPK11/14 (p38 MAP kinase) activation.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15728454 2005 Cutting edge: IL-4 induces suppressor of cytokine signaling-3 expression in B cells by a mechanism dependent on activation of p38 MAPK.
15708845 2005 Phosphorylation of c-Fos by members of the p38 MAPK family. Role in the AP-1 response to UV light.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15356147 2004 Histone deacetylase 3, a class I histone deacetylase, suppresses MAPK11-mediated activating transcription factor-2 activation and represses TNF gene expression.
15326477 2004 P38SAPK2 phosphorylates cyclin D3 at Thr-283 and targets it for proteasomal degradation.
15304344 2004 Signalling pathways involved in multisite phosphorylation of the transcription factor ATF-2.
15304097 2004 Cholesterol depletion upregulates involucrin expression in epidermal keratinocytes through activation of p38.
15273249 2004 Promyelocytic leukemia is a direct inhibitor of SAPK2/p38 mitogen-activated protein kinase.
15249224 2004 Basic fibroblast growth factor antagonizes activin A-mediated growth inhibition and hemoglobin synthesis in K562 cells by activating ERK1/2 and deactivating p38 MAP kinase.
15048855 2004 p38/SAPK2 controls gap junction closure in astrocytes.
14724572 2004 Phosphorylation of tyrosine 1214 on VEGFR2 is required for VEGF-induced activation of Cdc42 upstream of SAPK2/p38.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688370 2004 Soluble fractalkine prevents monocyte chemoattractant protein-1-induced monocyte migration via inhibition of stress-activated protein kinase 2/p38 and matrix metalloproteinase activities.
14680475 2004 Identification of glycogen synthase as a new substrate for stress-activated protein kinase 2b/p38beta.
14651992 2003 Increased atypical PKC activity in endurance-trained human skeletal muscle.
14557269 2003 Up-regulation of cyclooxygenase-2 and apoptosis resistance by p38 MAPK in hypericin-mediated photodynamic therapy of human cancer cells.
14522966 2003 Suppression of extracellular signal-related kinase and activation of p38 MAPK are two critical events leading to caspase-8- and mitochondria-mediated cell death in phytosphingosine-treated human cancer cells.
12586546 2002 Neurotoxicity of pneumolysin, a major pneumococcal virulence factor, involves calcium influx and depends on activation of p38 mitogen-activated protein kinase.
12510156 2003 Oxidative stress-induced apoptosis in dividing fibroblasts involves activation of p38 MAP kinase and over-expression of Bax: resistance of quiescent cells to oxidative stress.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475989 2003 p38 isoforms have opposite effects on AP-1-dependent transcription through regulation of c-Jun. The determinant roles of the isoforms in the p38 MAPK signal specificity.
12454855 2002 Differentiation state-selective roles of p38 isoforms in human intestinal epithelial cell anoikis.
12452429 2002 In the cellular garden of forking paths: how p38 MAPKs signal for downstream assistance.
12384504 2002 The transcriptional activator Mirk/Dyrk1B is sequestered by p38alpha/beta MAP kinase.
12171600 2002 Stress-induced regulation of eukaryotic elongation factor 2 kinase by SB 203580-sensitive and -insensitive pathways.
11579095 2001 The proto-oncoprotein Brx activates estrogen receptor beta by a p38 mitogen-activated protein kinase pathway.
11495898 2001 Nerve growth factor inhibits apoptosis in memory B lymphocytes via inactivation of p38 MAPK, prevention of Bcl-2 phosphorylation, and cytochrome c release.
11448946 2001 Transendothelial migration of colon carcinoma cells requires expression of E-selectin by endothelial cells and activation of stress-activated protein kinase-2 (SAPK2/p38) in the tumor cells.
11359773 2001 A Novel MAPK phosphatase MKP-7 acts preferentially on JNK/SAPK and p38 alpha and beta MAPKs.
11211234 2000 Phosphorylation of the common neurotrophin receptor p75 by p38beta2 kinase affects NF-kappaB and AP-1 activities.
11162833 2001 The Epstein-Barr virus latent membrane protein 1 induces interleukin-10 in Burkitt's lymphoma cells but not in Hodgkin's cells involving the p38/SAPK2 pathway.
11154262 2001 The mitogen-activated protein kinase signal-integrating kinase Mnk2 is a eukaryotic initiation factor 4E kinase with high levels of basal activity in mammalian cells.
10952989 2000 Osmotic stress regulates the stability of cyclin D1 in a p38SAPK2-dependent manner.
10878576 2000 p38 MAPK signalling cascades: ancient roles and new functions.
10820433 2000 Constitutive activity and differential localization of p38alpha and p38beta MAPKs in adult mouse brain.
10811012 2000 Coordinate activation of endogenous p38alpha, beta, gamma, and delta by inflammatory stimuli.
10782990 2000 p38/SAPK2-dependent gene expression in Jurkat T cells.
10744763 2000 Vascular endothelial growth factor (VEGF)-driven actin-based motility is mediated by VEGFR2 and requires concerted activation of stress-activated protein kinase 2 (SAPK2/p38) and geldanamycin-sensitive phosphorylation of focal adhesion kinase.
10608813 1999 A short lived protein involved in the heat shock sensing mechanism responsible for stress-activated protein kinase 2 (SAPK2/p38) activation.
10591208 1999 The DNA sequence of human chromosome 22.
10391889 1999 Stress-induced stimulation of early growth response gene-1 by p38/stress-activated protein kinase 2 is mediated by a cAMP-responsive promoter element in a MAPKAP kinase 2-independent manner.
10362531 1999 Activation of the neutrophil NADPH oxidase is inhibited by SB 203580, a specific inhibitor of SAPK2/p38.
10330143 1999 Targeting of p38 mitogen-activated protein kinases to MEF2 transcription factors.
10207622 1999 Regulation of actin dynamics by stress-activated protein kinase 2 (SAPK2)-dependent phosphorylation of heat-shock protein of 27 kDa (Hsp27).
10201954 1999 Differential expression and activation of p38 mitogen-activated protein kinase alpha, beta, gamma, and delta in inflammatory cell lineages.
9832563 1998 SAPK2/p38-dependent F-actin reorganization regulates early membrane blebbing during stress-induced apoptosis.
9687510 1998 Mitogen- and stress-activated protein kinase-1 (MSK1) is directly activated by MAPK and SAPK2/p38, and may mediate activation of CREB.
9632706 1998 Induction of apoptosis by SB202190 through inhibition of p38beta mitogen-activated protein kinase.
9628874 1998 PRAK, a novel protein kinase regulated by the p38 MAP kinase.
9430721 1998 Selective activation of p38 mitogen-activated protein (MAP) kinase isoforms by the MAP kinase kinases MKK3 and MKK6.
9235954 1997 p38-2, a novel mitogen-activated protein kinase with distinct properties.
9218798 1997 Activation of the novel stress-activated protein kinase SAPK4 by cytokines and cellular stresses is mediated by SKK3 (MKK6); comparison of its substrate specificity with that of other SAP kinases.
9207191 1997 Novel homologues of CSBP/p38 MAP kinase: activation, substrate specificity and sensitivity to inhibition by pyridinyl imidazoles.
9029150 1997 Activation of stress-activated protein kinase-3 (SAPK3) by cytokines and cellular stresses is mediated via SAPKK3 (MKK6); comparison of the specificities of SAPK3 and SAPK2 (RK/p38).
8663524 1996 Characterization of the structure and function of a new mitogen-activated protein kinase (p38beta).