Property Summary

NCBI Gene PubMed Count 68
PubMed Score 181.64
PubTator Score 84.39

Knowledge Summary

Patent (30,830)

Expression

Synonym

Accession P53779 A6NFS3 A6NG28 B3KQ94 Q15707 Q49AP1 MAP kinase 10
Symbols JNK3
JNK3A
PRKM10
SAPK1b
p493F12
p54bSAPK

Gene

PDB

4H36   1JNK   1PMN   1PMU   1PMV   2B1P   2EXC   2O0U   2O2U   2OK1   2P33   2R9S   2WAJ   2ZDT   2ZDU   3CGF   3CGO   3DA6   3FI2   3FI3   3FV8   3G90   3G9L   3G9N   3KVX   3OXI   3OY1   3PTG   3RTP   3TTI   3TTJ   3V6R   3V6S   4H39   4H3B   4KKE   4KKG   4KKH   4U79   4W4V   4W4W   4W4X   4W4Y   4WHZ   4X21   4Y46   4Y5H   4Z9L  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (1)

Gary Johnson 302 Kinome profile via MIB/MS Technology

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
746 screening 366 / 0 / 59439 Primary biochemical high-throughput screening assay for inhibitors of the c-Jun N-Terminal Kinase 3 (JNK3)
1284 confirmatory 57 / 0 / 305 Dose response biochemical screening assay for inhibitors of c-Jun N-Terminal Kinase 3 (JNK3)
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (34)

PMID Text
25475894 Data indicate that tetra-substituted pyridinylimidazoles were designed as dual inhibitors of c-Jun N-terminal kinase (JNK) 3 and p38alpha mitogen-activated protein (MAP) kinase, and both kinases may be involved in the progression of Huntington's disease.
25455349 Study found that JNK3 levels are increased in brain tissue and CSF from patients with Alzheimer disease and CSF levels could reflect the rate of cognitive decline
25178256 analysis of the unique mechanisms by which JNK1beta1 is regulated
25025079 JNK3 is required for the antiapoptotic effects of exendin 4
24767251 miR-29b mRNA, MAPK10 protein expression, and ATG9A protein expression are closely related to chemosensitivity of ovarian carcinoma.
24412749 Mitogen-activated protein kinase 10 JNK3 alpha (JNK3apha2)binds to both domains of arrestin-3.
23329067 reduced JNK3 activity has potentially deleterious effects on neuronal function via altered regulation of a set of post-synaptic proteins.
23142346 Subtle structural mechanisms for allosteric signaling between the peptide-binding site and activation loop of human JNK3.
22523077 Silent scaffolds: inhibition OF c-Jun N-terminal kinase 3 activity in cell by dominant-negative arrestin-3 mutant.
22047447 Arrestin-3 acts as a "true" scaffold, facilitating JNK3alpha2 phosphorylation by bringing it and MAP kinase kinase (MKK)4 together.
21321401 [review] This review focuses on delineating the role of scaffold proteins, especially that of JNK3 as a target, on the regulation of JNK signaling in neurons.
21166945 results suggest that MAPK10 may have a proapoptotic function and could function as a tumor-suppressor gene in chromophobe renal cell carcinoma
21041242 The results suggest the possible involvement of CaMKII and JNK3 in soman-induced long-term neurotoxicity.
20525557 JNK1, JNK2, and JNK3 are involved in P-glycoprotein-mediated multidrug resistance of hepatocellular carcinoma cells.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19001375 the molecular interactions of arrestin2 and arrestin3 and their individual domains with the components of the two MAPK cascades, ASK1-MKK4-JNK3 and c-Raf-1-MEK1-ERK2
18408005 JNK3 recruits MKK4 to the beta-arrestin-2 scaffold complex by binding to the MAPK docking domain (D-domain) located within the N terminus of MKK4.
17680991 Arrestin in all conformations binds JNK3 comparably, whereas Mdm2 preferentially binds cone arrestin 'frozen' in the basal state.
16737965 interaction of free arrestins with JNK3 and Mdm2 and their ability to regulate subcellular localization of these proteins may play an important role in the survival of photoreceptors and other neurons
16481105 The activation of mitogen-activated protein kinases (MAPKs, including ERK, JNK, and p38MAPK) is induced by incubation of HIV-1 gp160 with CD4+complement receptor type 2 (CR2)+ cells
15603708 The activation of mitogen-activated protein kinases (MAPKs, including ERK, JNK, and p38MAPK) is induced by incubation of HIV-1 gp160 with CD4+complement receptor type 2 (CR2)+ cells
15246824 The activation of mitogen-activated protein kinases (MAPKs, including ERK, JNK, and p38MAPK) is induced by incubation of HIV-1 gp160 with CD4+complement receptor type 2 (CR2)+ cells
12960231 The activation of mitogen-activated protein kinases (MAPKs, including ERK, JNK, and p38MAPK) is induced by incubation of HIV-1 gp160 with CD4+complement receptor type 2 (CR2)+ cells
12857973 The activation of mitogen-activated protein kinases (MAPKs, including ERK, JNK, and p38MAPK) is induced by incubation of HIV-1 gp160 with CD4+complement receptor type 2 (CR2)+ cells
12775419 The activation of mitogen-activated protein kinases (MAPKs, including ERK, JNK, and p38MAPK) is induced by incubation of HIV-1 gp160 with CD4+complement receptor type 2 (CR2)+ cells
12714584 The activation of mitogen-activated protein kinases (MAPKs, including ERK, JNK, and p38MAPK) is induced by incubation of HIV-1 gp160 with CD4+complement receptor type 2 (CR2)+ cells
12436199 Shares a promoter region with the tightly linked gene encoding Fas-associated phosphatase-1.
12239168 The activation of mitogen-activated protein kinases (MAPKs, including ERK, JNK, and p38MAPK) is induced by incubation of HIV-1 gp160 with CD4+complement receptor type 2 (CR2)+ cells
12089333 The activation of mitogen-activated protein kinases (MAPKs, including ERK, JNK, and p38MAPK) is induced by incubation of HIV-1 gp160 with CD4+complement receptor type 2 (CR2)+ cells
11698270 The activation of mitogen-activated protein kinases (MAPKs, including ERK, JNK, and p38MAPK) is induced by incubation of HIV-1 gp160 with CD4+complement receptor type 2 (CR2)+ cells
11504923 The activation of mitogen-activated protein kinases (MAPKs, including ERK, JNK, and p38MAPK) is induced by incubation of HIV-1 gp160 with CD4+complement receptor type 2 (CR2)+ cells
11468147 The activation of mitogen-activated protein kinases (MAPKs, including ERK, JNK, and p38MAPK) is induced by incubation of HIV-1 gp160 with CD4+complement receptor type 2 (CR2)+ cells
9403476 The activation of mitogen-activated protein kinases (MAPKs, including ERK, JNK, and p38MAPK) is induced by incubation of HIV-1 gp160 with CD4+complement receptor type 2 (CR2)+ cells
9045910 The activation of mitogen-activated protein kinases (MAPKs, including ERK, JNK, and p38MAPK) is induced by incubation of HIV-1 gp160 with CD4+complement receptor type 2 (CR2)+ cells

AA Sequence

MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPI      1 - 70
GSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQ     71 - 140
DVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGL    141 - 210
ARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLG    211 - 280
TPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISV    281 - 350
DDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA    351 - 420
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR                              421 - 464
//

Text Mined References (72)

PMID Year Title
25475894 2015 Tetra-substituted pyridinylimidazoles as dual inhibitors of p38? mitogen-activated protein kinase and c-Jun N-terminal kinase 3 for potential treatment of neurodegenerative diseases.
25455349 2015 Increased levels of cerebrospinal fluid JNK3 associated with amyloid pathology: links to cognitive decline.
25353672 2015 Genome wide association study identifies a novel putative mammographic density locus at 1q12-q21.
25178256 2014 Phosphorylation- and nucleotide-binding-induced changes to the stability and hydrogen exchange patterns of JNK1?1 provide insight into its mechanisms of activation.
25025079 2014 JNK3 is required for the cytoprotective effect of exendin 4.
25013167 2014 Evidence of efficient stop codon readthrough in four mammalian genes.
25009551 2014 The ATXN2-SH2B3 locus is associated with peripheral arterial disease: an electronic medical record-based genome-wide association study.
24767251 2014 Involvement of miR-29b signaling in the sensitivity to chemotherapy in patients with ovarian carcinoma.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
24412749 2014 Arrestin-3 binds the MAP kinase JNK3?2 via multiple sites on both domains.
23329067 2013 Characterisation of de novo MAPK10/JNK3 truncation mutations associated with cognitive disorders in two unrelated patients.
23142346 2012 Structural mechanisms of allostery and autoinhibition in JNK family kinases.
22523077 2012 Silent scaffolds: inhibition OF c-Jun N-terminal kinase 3 activity in cell by dominant-negative arrestin-3 mutant.
22441692 2012 JNK regulates the photic response of the mammalian circadian clock.
22047447 2011 Nonvisual arrestins function as simple scaffolds assembling the MKK4-JNK3?2 signaling complex.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21941371 2012 Isoform-specific palmitoylation of JNK regulates axonal development.
21321401 2011 JNK3 as a therapeutic target for neurodegenerative diseases.
21166945 2011 Identification of MAPK10 as a novel epigenetic marker for chromophobe kidney cancer.
21041242 2011 Regional alterations of JNK3 and CaMKII? subunit expression in the rat brain after soman poisoning.
20525557 2010 JNK1, JNK2, and JNK3 are involved in P-glycoprotein-mediated multidrug resistance of hepatocellular carcinoma cells.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19879840 2009 Beta-arrestin1 regulates zebrafish hematopoiesis through binding to YY1 and relieving polycomb group repression.
19782076 2009 A scanning peptide array approach uncovers association sites within the JNK/beta arrestin signalling complex.
19527717 2009 A selective small-molecule inhibitor of c-Jun N-terminal kinase 1.
19294699 2009 Proteomic analysis of GTP cyclohydrolase 1 multiprotein complexes in cultured normal adult human astrocytes under both basal and cytokine-activated conditions.
19001375 2009 How does arrestin assemble MAPKs into a signaling complex?
18435604 2008 Mutations of beta-arrestin 2 that limit self-association also interfere with interactions with the beta2-adrenoceptor and the ERK1/2 MAPKs: implications for beta2-adrenoceptor signalling via the ERK1/2 MAPKs.
18408005 2008 The beta-arrestin-2 scaffold protein promotes c-Jun N-terminal kinase-3 activation by binding to its nonconserved N terminus.
17680991 2007 Cone arrestin binding to JNK3 and Mdm2: conformational preference and localization of interaction sites.
16737965 2006 Visual and both non-visual arrestins in their "inactive" conformation bind JNK3 and Mdm2 and relocalize them from the nucleus to the cytoplasm.
16611996 2006 Neuroprotection by histone deacetylase-related protein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16249883 2006 Truncation of the CNS-expressed JNK3 in a patient with a severe developmental epileptic encephalopathy.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15693750 2005 Characterization of a novel human sperm-associated antigen 9 (SPAG9) having structural homology with c-Jun N-terminal kinase-interacting protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12818176 2003 JNK-mediated BIM phosphorylation potentiates BAX-dependent apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12436199 2002 Head-to-head juxtaposition of Fas-associated phosphatase-1 (FAP-1) and c-Jun NH2-terminal kinase 3 (JNK3) genes: genomic structure and seven polymorphisms of the FAP-1 gene.
12189133 2002 Phosphorylation-dependent scaffolding role of JSAP1/JIP3 in the ASK1-JNK signaling pathway. A new mode of regulation of the MAP kinase cascade.
12167088 2002 A new c-Jun N-terminal kinase (JNK)-interacting protein, Sab (SH3BP5), associates with mitochondria.
11823425 2002 Cyclin-dependent kinase 5 prevents neuronal apoptosis by negative regulation of c-Jun N-terminal kinase 3.
11726686 2001 Misreading of termination codons in eukaryotes by natural nonsense suppressor tRNAs.
11718727 2001 c-Jun N-terminal kinase-3 (JNK3)/stress-activated protein kinase-beta (SAPKbeta) binds and phosphorylates the neuronal microtubule regulator SCG10.
11359773 2001 A Novel MAPK phosphatase MKP-7 acts preferentially on JNK/SAPK and p38 alpha and beta MAPKs.
11356842 2001 Identification of a motif in the carboxyl terminus of beta -arrestin2 responsible for activation of JNK3.
11322657 2001 The c-Jun NH2-terminal kinase3 (JNK3) gene: genomic structure, chromosomal assignment, and loss of expression in brain tumors.
11259409 2001 Identification of new JNK substrate using ATP pocket mutant JNK and a corresponding ATP analogue.
11231586 2001 ERK phosphorylation drives cytoplasmic accumulation of hnRNP-K and inhibition of mRNA translation.
11185509 2000 Signal transduction. An arresting start for MAPK.
11090355 2000 Beta-arrestin 2: a receptor-regulated MAPK scaffold for the activation of JNK3.
11062067 2000 Synergistic activation of stress-activated protein kinase 1/c-Jun N-terminal kinase (SAPK1/JNK) isoforms by mitogen-activated protein kinase kinase 4 (MKK4) and MKK7.
10878576 2000 p38 MAPK signalling cascades: ancient roles and new functions.
10715136 2000 Activation of JNK3 alpha 1 requires both MKK4 and MKK7: kinetic characterization of in vitro phosphorylated JNK3 alpha 1.
10629060 2000 Interaction of a mitogen-activated protein kinase signaling module with the neuronal protein JIP3.
10523642 1999 JSAP1, a novel jun N-terminal protein kinase (JNK)-binding protein that functions as a Scaffold factor in the JNK signaling pathway.
10471813 1999 A novel Jun N-terminal kinase (JNK)-binding protein that enhances the activation of JNK by MEK kinase 1 and TGF-beta-activated kinase 1.
9847074 1998 Toward a complete human genome sequence.
9739089 1998 Crystal structure of JNK3: a kinase implicated in neuronal apoptosis.
9393873 1997 JNK1, JNK2 and JNK3 are p53 N-terminal serine 34 kinases.
9349820 1997 Absence of excitotoxicity-induced apoptosis in the hippocampus of mice lacking the Jnk3 gene.
9110174 1997 Large-scale concatenation cDNA sequencing.
8654373 1996 Selective interaction of JNK protein kinase isoforms with transcription factors.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7826642 1995 p493F12 kinase: a novel MAP kinase expressed in a subset of neurons in the human nervous system.
1922387 1991 Phosphorylation of c-jun mediated by MAP kinases.