Property Summary

NCBI Gene PubMed Count 20
PubMed Score 26.22
PubTator Score 18.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
posterior fossa group B ependymoma -1.600 1.4e-04
psoriasis 1.100 4.9e-04
glioblastoma -2.100 9.1e-07
oligodendroglioma -1.100 1.9e-09
sonic hedgehog group medulloblastoma -3.200 3.3e-06
atypical teratoid/rhabdoid tumor -1.700 6.0e-05
medulloblastoma, large-cell -1.500 3.5e-02
primitive neuroectodermal tumor -1.800 1.8e-02
non-small cell lung cancer 1.036 5.8e-11
lung cancer 1.200 2.0e-02
interstitial cystitis -1.800 2.6e-05
pediatric high grade glioma -2.000 2.7e-05
pilocytic astrocytoma -1.500 6.5e-04
subependymal giant cell astrocytoma -3.950 3.1e-03
lung carcinoma 1.800 3.5e-31
Alzheimer's disease 1.200 4.8e-02
Pick disease 1.600 7.7e-04
progressive supranuclear palsy -1.100 1.5e-02
invasive ductal carcinoma 1.100 5.9e-03

Pathway (1)

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18695889 the expression ratio of Map7/B2M may serve as a valuable prognostic marker in patients with Stage II colon cancer
15218243 Study of 117 patients suggests MAP7 as a candidate gene for sacral dysgenesis. However, we were unable to detect any sacral defects in the MAP7 knockout mice.

AA Sequence

MAELGAGGDGHRGGDGAVRSETAPDSYKVQDKKNASSRPASAISGQNNNHSGNKPDPPPVLRVDDRQRLA      1 - 70
RERREEREKQLAAREIVWLEREERARQHYEKHLEERKKRLEEQRQKEERRRAAVEEKRRQRLEEDKERHE     71 - 140
AVVRRTMERSQKPKQKHNRWSWGGSLHGSPSIHSADPDRRSVSTMNLSKYVDPVISKRLSSSSATLLNSP    141 - 210
DRARRLQLSPWESSVVNRLLTPTHSFLARSKSTAALSGEAASCSPIIMPYKAAHSRNSMDRPKLFVTPPE    211 - 280
GSSRRRIIHGTASYKKERERENVLFLTSGTRRAVSPSNPKARQPARSRLWLPSKSLPHLPGTPRPTSSLP    281 - 350
PGSVKAAPAQVRPPSPGNIRPVKREVKVEPEKKDPEKEPQKVANEPSLKGRAPLVKVEEATVEERTPAEP    351 - 420
EVGPAAPAMAPAPASAPAPASAPAPAPVPTPAMVSAPSSTVNASASVKTSAGTTDPEEATRLLAEKRRLA    421 - 490
REQREKEERERREQEELERQKREELAQRVAEERTTRREEESRRLEAEQAREKEEQLQRQAEERALREREE    491 - 560
AERAQRQKEEEARVREEAERVRQEREKHFQREEQERLERKKRLEEIMKRTRRTEATDKKTSDQRNGDIAK    561 - 630
GALTGGTEVSALPCTTNAPGNGKPVGSPHVVTSHQSKVTVESTPDLEKQPNENGVSVQNENFEEIINLPI    631 - 700
GSKPSRLDVTNSESPEIPLNPILAFDDEGTLGPLPQVDGVQTQQTAEVI                         701 - 749
//

Text Mined References (34)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18695889 2008 The expression ratio of Map7/B2M is prognostic for survival in patients with stage II colon cancer.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15218243 2004 Cloning and characterization of an inversion breakpoint at 6q23.3 suggests a role for Map7 in sacral dysgenesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14517216 2003 Microtubule-associated [corrected] protein 7 increases the membrane expression of transient receptor potential vanilloid 4 (TRPV4).
12845596 2003 Expression and distribution of distinct variants of E-MAP-115 during proliferation and differentiation of human intestinal epithelial cells.
12755995 2003 Microtubule-associated epithelial protein E-MAP-115 is localized in the spermatid manchette.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11719555 2001 Rapid dynamics of the microtubule binding of ensconsin in vivo.
9989799 1999 Upregulation and redistribution of E-MAP-115 (epithelial microtubule-associated protein of 115 kDa) in terminally differentiating keratinocytes is coincident with the formation of intercellular contacts.
8408219 1993 Identification and molecular characterization of E-MAP-115, a novel microtubule-associated protein predominantly expressed in epithelial cells.
7490279 1995 Binding of E-MAP-115 to microtubules is regulated by cell cycle-dependent phosphorylation.