Property Summary

NCBI Gene PubMed Count 21
PubMed Score 28.89
PubTator Score 18.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.200 2.8e-02
Alzheimer's disease 1.200 4.8e-02
Astrocytoma, Pilocytic -1.500 6.0e-04
atypical teratoid / rhabdoid tumor -1.500 1.5e-03
ependymoma -1.300 1.2e-02
glioblastoma -1.100 7.1e-05
group 4 medulloblastoma -1.700 3.1e-03
interstitial cystitis -1.500 1.5e-03
invasive ductal carcinoma 1.100 5.9e-03
lung cancer 1.200 2.0e-02
lung carcinoma 1.800 3.5e-31
medulloblastoma, large-cell -1.500 3.5e-02
non-small cell lung cancer 1.036 5.8e-11
oligodendroglioma -1.100 1.9e-09
Pick disease 1.600 7.7e-04
primitive neuroectodermal tumor -1.800 1.8e-02
progressive supranuclear palsy -1.100 1.5e-02
psoriasis 1.100 4.9e-04
subependymal giant cell astrocytoma -2.045 3.6e-03

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MAELGAGGDGHRGGDGAVRSETAPDSYKVQDKKNASSRPASAISGQNNNHSGNKPDPPPVLRVDDRQRLA      1 - 70
RERREEREKQLAAREIVWLEREERARQHYEKHLEERKKRLEEQRQKEERRRAAVEEKRRQRLEEDKERHE     71 - 140
AVVRRTMERSQKPKQKHNRWSWGGSLHGSPSIHSADPDRRSVSTMNLSKYVDPVISKRLSSSSATLLNSP    141 - 210
DRARRLQLSPWESSVVNRLLTPTHSFLARSKSTAALSGEAASCSPIIMPYKAAHSRNSMDRPKLFVTPPE    211 - 280
GSSRRRIIHGTASYKKERERENVLFLTSGTRRAVSPSNPKARQPARSRLWLPSKSLPHLPGTPRPTSSLP    281 - 350
PGSVKAAPAQVRPPSPGNIRPVKREVKVEPEKKDPEKEPQKVANEPSLKGRAPLVKVEEATVEERTPAEP    351 - 420
EVGPAAPAMAPAPASAPAPASAPAPAPVPTPAMVSAPSSTVNASASVKTSAGTTDPEEATRLLAEKRRLA    421 - 490
REQREKEERERREQEELERQKREELAQRVAEERTTRREEESRRLEAEQAREKEEQLQRQAEERALREREE    491 - 560
AERAQRQKEEEARVREEAERVRQEREKHFQREEQERLERKKRLEEIMKRTRRTEATDKKTSDQRNGDIAK    561 - 630
GALTGGTEVSALPCTTNAPGNGKPVGSPHVVTSHQSKVTVESTPDLEKQPNENGVSVQNENFEEIINLPI    631 - 700
GSKPSRLDVTNSESPEIPLNPILAFDDEGTLGPLPQVDGVQTQQTAEVI                         701 - 749
//

Text Mined References (36)

PMID Year Title