Property Summary

NCBI Gene PubMed Count 19
PubMed Score 102.94
PubTator Score 27.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.072 3.7e-03
adult high grade glioma -1.200 3.9e-03
Astrocytoma, Pilocytic -1.100 6.8e-06
glioblastoma -1.100 1.1e-04
group 4 medulloblastoma 1.200 4.2e-04
primitive neuroectodermal tumor 1.400 3.2e-02
psoriasis -1.600 4.1e-84

Gene RIF (7)

AA Sequence

MAWPCITRACCIARFWNQLDKADIAVPLVFTKYSEATEHPGAPPQPPPPQQQAQPALAPPSARAVAIETQ      1 - 70
PAQGELDAVARATGPAPGPTGEREPAAGPGRSGPGPGLGSGSTSGPADSVMRQDYRAWKVQRPEPSCRPR     71 - 140
SEYQPSDAPFERETQYQKDFRAWPLPRRGDHPWIPKPVQISAASQASAPILGAPKRRPQSQERWPVQAAA    141 - 210
EAREQEAAPGGAGGLAAGKASGADERDTRRKAGPAWIVRRAEGLGHEQTPLPAAQAQVQATGPEAGRGRA    211 - 280
AADALNRQIREEVASAVSSSYRNEFRAWTDIKPVKPIKAKPQYKPPDDKMVHETSYSAQFKGEASKPTTA    281 - 350
DNKVIDRRRIRSLYSEPFKEPPKVEKPSVQSSKPKKTSASHKPTRKAKDKQAVSGQAAKKKSAEGPSTTK    351 - 420
PDDKEQSKEMNNKLAEAKESLAQPVSDSSKTQGPVATEPDKDQGSVVPGLLKGQGPMVQEPLKKQGSVVP    421 - 490
GPPKDLGPMIPLPVKDQDHTVPEPLKNESPVISAPVKDQGPSVPVPPKNQSPMVPAKVKDQGSVVPESLK    491 - 560
DQGPRIPEPVKNQAPMVPAPVKDEGPMVSASVKDQGPMVSAPVKDQGPIVPAPVKGEGPIVPAPVKDEGP    561 - 630
MVSAPIKDQDPMVPEHPKDESAMATAPIKNQGSMVSEPVKNQGLVVSGPVKDQDVVVPEHAKVHDSAVVA    631 - 700
PVKNQGPVVPESVKNQDPILPVLVKDQGPTVLQPPKNQGRIVPEPLKNQVPIVPVPLKDQDPLVPVPAKD    701 - 770
QGPAVPEPLKTQGPRDPQLPTVSPLPRVMIPTAPHTEYIESSP                               771 - 813
//

Text Mined References (21)

PMID Year Title