Property Summary

NCBI Gene PubMed Count 23
PubMed Score 56.88
PubTator Score 8.51

Knowledge Summary

Patent (7,150)

Synonym

Accession Q9Y4K4 Q8IYF6
Symbols KHS
GCKR
KHS1
MAPKKKK5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (1)

Gary Johnson 302 Kinome profile via MIB/MS Technology

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (3)

PMID Text
27023625 MAP4K5 expression is decreased or lost in majority of pancreatic ductal adenocarcinoma.
16699725 The -822G/A polymorphism in the promoter region of the MAP4K5 gene is associated with reduced risk of type 2 diabetes in Han Chinese from Shanghai.
12591926 TNF signaling leads to oligomerization, ubiquitination, and activation of GCKR and activation of the SAPK pathway in a manner that depends upon TRAF2 polyubiquitination and oligomerization and Ubc13 function

AA Sequence

MEAPLRPAADILRRNPQQDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFSLIQQEIFMVK      1 - 70
ECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIYHVTGPLSELQIAYVCRETLQGLAYLHTKGKMHRD     71 - 140
IKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVEKNGGYNQLCDIWAVGITAIE    141 - 210
LGELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTHTFVAQP    211 - 280
GLSRALAVELLDKVNNPDNHAHYTEADDDDFEPHAIIRHTIRSTNRNARAERTASEINFDKLQFEPPLRK    281 - 350
ETEARDEMGLSSDPNFMLQWNPFVDGANTGKSTSKRAIPPPLPPKPRISSYPEDNFPDEEKASTIKHCPD    351 - 420
SESRAPQILRRQSSPSCGPVAETSSIGNGDGISKLMSENTEGSAQAPQLPRKNDKRDFPKPAINGLPPTP    421 - 490
KVLMGACFSKVFDGCPLKINCATSWIHPDTKDQYIIFGTEDGIYTLNLNELHEATMEQLFPRKCTWLYVI    491 - 560
NNTLMSLSEGKTFQLYSHNLIALFEHAKKPGLAAHIQTHRFPDRILPRKFALTTKIPDTKGCHKCCIVRN    561 - 630
PYTGHKYLCGALQSGIVLLQWYEPMQKFMLIKHFDFPLPSPLNVFEMLVIPEQEYPMVCVAISKGTESNQ    631 - 700
VVQFETINLNSASSWFTEIGAGSQQLDSIHVTQLERDTVLVCLDKFVKIVNLQGKLKSSKKLASELSFDF    701 - 770
RIESVVCLQDSVLAFWKHGMQGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA    771 - 840
GHENSY                                                                    841 - 846
//

Text Mined References (27)

PMID Year Title
27023625 2016 Prognostic and Functional Significance of MAP4K5 in Pancreatic Cancer.
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
20936779 2010 A human MAP kinase interactome.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19380743 2009 Charting the molecular network of the drug target Bcr-Abl.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
16699725 2006 The -822G/A polymorphism in the promoter region of the MAP4K5 gene is associated with reduced risk of type 2 diabetes in Chinese Hans from Shanghai.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12591926 2003 Tumor necrosis factor (TNF)-induced germinal center kinase-related (GCKR) and stress-activated protein kinase (SAPK) activation depends upon the E2/E3 complex Ubc13-Uev1A/TNF receptor-associated factor 2 (TRAF2).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10648385 2000 Adaptor proteins CRK and CRKL associate with the serine/threonine protein kinase GCKR promoting GCKR and SAPK activation.
10490605 1999 TANK potentiates tumor necrosis factor receptor-associated factor-mediated c-Jun N-terminal kinase/stress-activated protein kinase activation through the germinal center kinase pathway.
10477597 1999 TNF-mediated activation of the stress-activated protein kinase pathway: TNF receptor-associated factor 2 recruits and activates germinal center kinase related.
9949177 1999 GCKR links the Bcr-Abl oncogene and Ras to the stress-activated protein kinase pathway.
9788432 1998 The germinal center kinase (GCK)-related protein kinases HPK1 and KHS are candidates for highly selective signal transducers of Crk family adapter proteins.
9038372 1997 A novel human SPS1/STE20 homologue, KHS, activates Jun N-terminal kinase.
8274451 1993 Identification of 21 novel human protein kinases, including 3 members of a family related to the cell cycle regulator nimA of Aspergillus nidulans.