Property Summary

NCBI Gene PubMed Count 36
PubMed Score 141.31
PubTator Score 52.17

Knowledge Summary

Patent (49,874)

Expression

  Differential Expression (21)

Disease log2 FC p
nephrosclerosis 1.110 8.4e-04
chronic lymphocytic leukemia -1.331 9.2e-05
astrocytic glioma 1.600 2.3e-02
oligodendroglioma 2.000 7.2e-03
sonic hedgehog group medulloblastoma 1.600 2.2e-04
primitive neuroectodermal tumor 1.300 1.9e-02
Atopic dermatitis 1.100 1.9e-04
primary pancreatic ductal adenocarcinoma 1.431 5.9e-03
intraductal papillary-mucinous adenoma (... 1.500 7.9e-03
intraductal papillary-mucinous carcinoma... 1.500 8.0e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.9e-02
lung cancer 1.400 1.3e-04
pancreatic cancer 1.200 3.4e-04
diabetes mellitus -1.300 2.6e-03
interstitial cystitis 1.200 1.6e-04
primary Sjogren syndrome 1.200 7.2e-03
Pick disease 1.100 9.2e-04
gastric carcinoma 1.800 2.4e-02
ulcerative colitis 1.700 7.6e-05
ovarian cancer 2.600 1.2e-05
Down syndrome 1.600 4.5e-03

Gene RIF (17)

PMID Text
26722431 miR-194 regulated the progression of hepatocellular carcinoma through directly inhibiting the expression of MAP4K4
26549737 The results of the present study suggested that inhibition of MAP4K4 may be a therapeutic strategy for gastric cancer.
25799996 loss of MAP4K4 function suppressed pathological angiogenesis in disease models, identifying MAP4K4 as a potential therapeutic target
24244164 that MAP4K4, a known mediator of inflammation, is involved in KS aetiology by regulating KSHV lytic reactivation
24233838 results reveal a key target of SOX2 expression and highlight the unexpected context-dependent role for MAP4K4, a pluripotent activator of several mitogen-activated protein kinase pathways, in regulating tumor cell survival.
23543740 TRAF1.NIK is a central complex linking canonical and non-canonical pathways by disrupting the TRAF2-cIAP2 ubiquitin ligase complex
23094072 Common polymorphisms in MAP4K4 are associated with insulin resistance and beta-cell dysfunction, possibly via this gene's role in inflammatory signaling.
22824148 Elevated MAP4K4 expression is closely associated with lung adenocarcinoma progression with independent prognostic value in predicting overall survival for patients with lung adenocarcinoma.
21196414 MAP4K4 overexpression is an independent predictor of poor prognosis of Hepatocellular Carcinoma patients, and inhibition of its expression might be of therapeutic significance
20857524 Data show that down-regulation of hepatocyte progenitor kinase-like kinase (HGK) can obviously inhibit the migration and invasion of HepG2 cells in vitro, and suggest that HGK may be a new therapeutic target for treatment of hepatocellular carcinoma.
19690174 Results identify MAP4K4 as a key upstream mediator of TNF-alpha action on the beta cell, preventing tumor necrosis factor-alpha-induced decrease of IRS-2 and inhibition of glucose-stimulated insulin secretion.
18981001 MAP4K4 expression significantly correlated with overall and recurrence-free survival (P=0.025 and 0.004) independent of age, tumor size, differentiation, and stage.
17227768 MAP4K4 silencing prevents TNFa-induced insulin resistance in human skeletal muscle and restores appropriate signaling inputs to enhance glucose uptake
16537454 studies of the promigratory role of MAP4K4 showed that the knockdown of this transcript inhibited the migration of multiple carcinoma cell lines, indicating a broad role in cell motility
14966141 MAP4K4 is a putative effector of Rap2, a Ras family small GTP-binding protein, mediating the activation of JNK by Rap2
12612079 The STE20 kinase HGK is broadly expressed in human tumor cells and can modulate cellular transformation, invasion, and adhesion.
12387898 interaction with GBP3

AA Sequence

MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEI      1 - 70
NMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRG     71 - 140
LAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATY    141 - 210
DYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPST    211 - 280
EQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGES    281 - 350
TLRRDFLRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR    351 - 420
RQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLEVLQQQLLQEQ    421 - 490
AMLLECRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRPHPQHSQQPPPPQQERSKPSFHAPEPKAHY    491 - 560
EPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPSRSESFSNGNSESVHPALQRPAEPQVPVRTTSR    561 - 630
SPVLSRRDSPLQGSGQQNSQAGQRNSTSIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGS    631 - 700
GERFRVRSSSKSEGSPSQRLENAVKKPEDKKEVFRPLKPADLTALAKELRAVEDVRPPHKVTDYSSSSEE    701 - 770
SGTTDEEDDDVEQEGADESTSGPEDTRAASSLNLSNGETESVKTMIVHDDVESEPAMTPSKEGTLIVRQT    771 - 840
QSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVGFSCDGMRPEAIRQDPTRKGSVVNVNPTNTR    841 - 910
PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLV    911 - 980
TISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAW    981 - 1050
APKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPH   1051 - 1120
AIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGH   1121 - 1190
LDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW                        1191 - 1239
//

Text Mined References (50)

PMID Year Title
26722431 2015 MicroRNA-194 acts as a prognostic marker and inhibits proliferation in hepatocellular carcinoma by targeting MAP4K4.
26549737 2016 Silencing of MAP4K4 by short hairpin RNA suppresses proliferation, induces G1 cell cycle arrest and induces apoptosis in gastric cancer cells.
25799996 2015 MAP4K4 regulates integrin-FERM binding to control endothelial cell motility.
25625039 2015 The Ser/Thr kinase MAP4K4 drives c-Met-induced motility and invasiveness in a cell-based model of SHH medulloblastoma.
25601402 2015 The Nck-interacting kinase NIK increases Arp2/3 complex activity by phosphorylating the Arp2 subunit.
24626571 2014 Intracellular Theileria annulata promote invasive cell motility through kinase regulation of the host actin cytoskeleton.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24244164 2013 The inflammatory kinase MAP4K4 promotes reactivation of Kaposi's sarcoma herpesvirus and enhances the invasiveness of infected endothelial cells.
24233838 2014 SOX2 regulates apoptosis through MAP4K4-survivin signaling pathway in human lung cancer cells.
23543740 2013 Inducible tumor necrosis factor (TNF) receptor-associated factor-1 expression couples the canonical to the non-canonical NF-?B pathway in TNF stimulation.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23207904 2013 Identification of Map4k4 as a novel suppressor of skeletal muscle differentiation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23094072 2012 Association of common genetic variants in the MAP4K4 locus with prediabetic traits in humans.
22824148 2012 Expression and prognostic significance of MAP4K4 in lung adenocarcinoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
21690388 2011 Smad inhibition by the Ste20 kinase Misshapen.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21196414 2011 ShRNA-targeted MAP4K4 inhibits hepatocellular carcinoma growth.
20857524 2010 Lowered HGK expression inhibits cell invasion and adhesion in hepatocellular carcinoma cell line HepG2.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19690174 2009 Silencing mitogen-activated protein 4 kinase 4 (MAP4K4) protects beta cells from tumor necrosis factor-alpha-induced decrease of IRS-2 and inhibition of glucose-stimulated insulin secretion.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18981001 2008 Expression of MAP4K4 is associated with worse prognosis in patients with stage II pancreatic ductal adenocarcinoma.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17227768 2007 MAP4K4 gene silencing in human skeletal muscle prevents tumor necrosis factor-alpha-induced insulin resistance.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
16537454 2006 A small interfering RNA screen for modulators of tumor cell motility identifies MAP4K4 as a promigratory kinase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14966141 2004 Mitogen-activated protein kinase kinase kinase kinase 4 as a putative effector of Rap2 to activate the c-Jun N-terminal kinase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12612079 2003 The STE20 kinase HGK is broadly expressed in human tumor cells and can modulate cellular transformation, invasion, and adhesion.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12387898 2002 A novel GTP-binding protein hGBP3 interacts with NIK/HGK.
12185077 2002 S9, a 19 S proteasome subunit interacting with ubiquitinated NF-kappaB2/p100.
11967148 2002 A conserved interaction between beta1 integrin/PAT-3 and Nck-interacting kinase/MIG-15 that mediates commissural axon navigation in C. elegans.
11369779 2001 The Nck-interacting kinase (NIK) phosphorylates the Na+-H+ exchanger NHE1 and regulates NHE1 activation by platelet-derived growth factor.
10805734 2000 Interaction between PAK and nck: a template for Nck targets and role of PAK autophosphorylation.
10669731 2000 Nck-interacting Ste20 kinase couples Eph receptors to c-Jun N-terminal kinase and integrin activation.
9890973 1999 A novel human STE20-related protein kinase, HGK, that specifically activates the c-Jun N-terminal kinase signaling pathway.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9135144 1997 NIK is a new Ste20-related kinase that binds NCK and MEKK1 and activates the SAPK/JNK cascade via a conserved regulatory domain.