Property Summary

NCBI Gene PubMed Count 39
PubMed Score 30.65
PubTator Score 38.25

Knowledge Summary

Patent (4,503)

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 8.2e-03
osteosarcoma -2.753 7.9e-08
intraductal papillary-mucinous neoplasm ... -1.200 2.4e-02
interstitial cystitis 1.900 4.8e-04
primary Sjogren syndrome 1.200 6.1e-03

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (18)

PMID Text
24362026 CUL7/Fbxw8 ubiquitin ligase-mediated HPK1 degradation revealed a direct link and novel role of CUL7/Fbxw8 ubiquitin ligase in the MAPK pathway, which plays a critical role in cell proliferation and differentiation.
23460610 HPK1 is critically involved in LFA-1-mediated polymorphonuclear neutrophils trafficking during acute inflammation.
22801218 Pdcd4 knockdown up-regulates MAP kinase kinase kinase kinase 1 (MAP4K1) expression and increases phosphorylation of c-Jun.
22541691 QVD and 1,25D-induced differentiation was accompanied by increased signaling by Hematopoietic Progenitor Kinase 1(HPK1), and the expression of transcription factors known to be involved in monocytic differentiation was increased.
22421156 results indicate that uncleaved HPK1 is a positive regulator of vitamin D-induced differentiation in acute myeloid leukemia cells, but the cleaved HPK1 fragment inhibits differentiation
22105350 HPK1 negatively regulates T cell activation by reducing the persistence of signaling microclusters.
21915030 The purpose of the study was to investigate the potential contribution of HPK1, MEKK1, TAK1, p-MKK4 to the development of extramammary Paget disease
19706536 Results suggest HPK1-mediated phosphorylation of CARMA1 as an additional regulatory mechanism tuning the NF-kappaB response upon TCR stimulation.
19141650 Restoring wild-type HPK1 protein in pancreatic cancer cells led to the increase in p21 and p27 protein expression and cell cycle arrest. HPK1 may function as a novel tumor suppressor and its loss plays a critical role in pancreatic cancer.
17895239 Prostaglandin E2 activates HPK1 kinase activity via a PKA-dependent pathway
17712048 HPK1-C as a suppressor of antiapoptotic Bcl-2 proteins and provide a molecular basis for our understanding of CD95L-independent activation-induced cell death of lymphocytes.
17353368 A novel negative feedback loop involves HPK-1-dependent serine phosphorylation of SLP-76 and 14-3-3 protein recruitment, which tunes T cell activation.
17024227 Our work explains growth factor-independent survival during monocytic differentiation by caspase-mediated processing of HPK1 towards HPK1-N.
16449643 Pdcd4 suppresses tumor progression in colon carcinoma cells by the novel mechanism of down-regulating MAP4K1 transcription, with consequent inhibition of c-Jun activation and AP-1-dependent transcription.
16341093 suppression or activation of NFkappaB by HPK1 determines sensitivity to activation-induced cell death
15743830 Full activation of HPK1 is dependent on autophosphorylation of threonine 165 and phosphorylation of serine 171, which is a target site for protein kinase D (PKD) in vitro.
15364934 PP4 is a positive regulator for HPK1 and the HPK1-JNK signaling pathway
12522005 The catalytic activity of a hematopoietic cell-restricted, Ste20-related S/TPK, HPK1, is positively regulated by exposure to physiological concentrations of PGE2. HPK1 is a negative regulator of PGE2-induced FOS gene transcription.

AA Sequence

MDVVDPDIFNRDPRDHYDLLQRLGGGTYGEVFKARDKVSGDLVALKMVKMEPDDDVSTLQKEILILKTCR      1 - 70
HANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKG     71 - 140
ANILINDAGEVRLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAE    141 - 210
LQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATKMLSHQLVSQPGLN    211 - 280
RGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETR    281 - 350
PPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPSDEGPGSMGDDGQL    351 - 420
SPGVLVRCASGPPPNSPRPGPPPSTSSPHLTAHSEPSLWNPPSRELDKPPLLPPKKEKMKRKGCALLVKL    421 - 490
FNGCPLRIHSTAAWTHPSTKDQHLLLGAEEGIFILNRNDQEATLEMLFPSRTTWVYSINNVLMSLSGKTP    491 - 560
HLYSHSILGLLERKETRAGNPIAHISPHRLLARKNMVSTKIQDTKGCRACCVAEGASSGGPFLCGALETS    561 - 630
VVLLQWYQPMNKFLLVRQVLFPLPTPLSVFALLTGPGSELPAVCIGVSPGRPGKSVLFHTVRFGALSCWL    631 - 700
GEMSTEHRGPVQVTQVEEDMVMVLMDGSVKLVTPEGSPVRGLRTPEIPMTEAVEAVAMVGGQLQAFWKHG    701 - 770
VQVWALGSDQLLQELRDPTLTFRLLGSPRLECSGTISPHCNLLLPGSSNSPASASRVAGITGL           771 - 833
//

Text Mined References (44)

PMID Year Title
24362026 2014 The CUL7/F-box and WD repeat domain containing 8 (CUL7/Fbxw8) ubiquitin ligase promotes degradation of hematopoietic progenitor kinase 1.
23460610 2013 Hematopoietic progenitor kinase 1 (HPK1) is required for LFA-1-mediated neutrophil recruitment during the acute inflammatory response.
22801218 2012 Pdcd4 knockdown up-regulates MAP4K1 expression and activation of AP-1 dependent transcription through c-Myc.
22541691 2012 The pan-caspase inhibitor Q-VD-OPh has anti-leukemia effects and can interact with vitamin D analogs to increase HPK1 signaling in AML cells.
22421156 2012 Dual role of hematopoietic progenitor kinase 1 (HPK1) as a positive regulator of 1?,25-dihydroxyvitamin D-induced differentiation and cell cycle arrest of AML cells and as a mediator of vitamin D resistance.
22105350 2011 Release of serine/threonine-phosphorylated adaptors from signaling microclusters down-regulates T cell activation.
21915030 2011 Hematopoietic progenitor kinase 1, mitogen-activated protein/extracellular signal-related protein kinase kinase kinase 1, and phosphomitogen-activated protein kinase kinase 4 are overexpressed in extramammary Paget disease.
21269460 2011 Initial characterization of the human central proteome.
20231852 2010 CD150 regulates JNK1/2 activation in normal and Hodgkin's lymphoma B cells.
19946888 2010 Defining the membrane proteome of NK cells.
19706536 2009 Phosphorylation of CARMA1 by HPK1 is critical for NF-kappaB activation in T cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19141650 2009 Proteasome-mediated degradation and functions of hematopoietic progenitor kinase 1 in pancreatic cancer.
17895239 2007 Prostaglandin E2 activates HPK1 kinase activity via a PKA-dependent pathway.
17712048 2007 Caspase-cleaved HPK1 induces CD95L-independent activation-induced cell death in T and B lymphocytes.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17353368 2007 A novel pathway down-modulating T cell activation involves HPK-1-dependent recruitment of 14-3-3 proteins on SLP-76.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17024227 2007 Sustained JNK signaling by proteolytically processed HPK1 mediates IL-3 independent survival during monocytic differentiation.
16449643 2006 Tumorigenesis suppressor Pdcd4 down-regulates mitogen-activated protein kinase kinase kinase kinase 1 expression to suppress colon carcinoma cell invasion.
16341093 2005 Activation or suppression of NFkappaB by HPK1 determines sensitivity to activation-induced cell death.
15743830 2005 Activation of hematopoietic progenitor kinase 1 involves relocation, autophosphorylation, and transphosphorylation by protein kinase D1.
15364934 2004 Protein phosphatase 4 is a positive regulator of hematopoietic progenitor kinase 1.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14563325 2003 Bam32 links the B cell receptor to ERK and JNK and mediates B cell proliferation but not survival.
12522005 2003 Hematopoietic progenitor kinase 1 (HPK1) negatively regulates prostaglandin E2-induced fos gene transcription.
11514608 2001 B cell adaptor containing src homology 2 domain (BASH) links B cell receptor signaling to the activation of hematopoietic progenitor kinase 1.
11487585 2001 Hematopoietic progenitor kinase 1 associates physically and functionally with the adaptor proteins B cell linker protein and SLP-76 in lymphocytes.
11432831 2001 A direct interaction between JNK1 and CrkII is critical for Rac1-induced JNK activation.
11313918 2001 Leukocyte-specific adaptor protein Grap2 interacts with hematopoietic progenitor kinase 1 (HPK1) to activate JNK signaling pathway in T lymphocytes.
11279207 2001 Involvement of hematopoietic progenitor kinase 1 in T cell receptor signaling.
11278340 2001 Interaction of hematopoietic progenitor kinase 1 and c-Abl tyrosine kinase in response to genotoxic stress.
11053428 2001 The kinase activation loop is the key to mixed lineage kinase-3 activation via both autophosphorylation and hematopoietic progenitor kinase 1 phosphorylation.
10602493 1999 Caspase-mediated cleavage and functional changes of hematopoietic progenitor kinase 1 (HPK1).
10567356 1999 A novel src homology 3 domain-containing adaptor protein, HIP-55, that interacts with hematopoietic progenitor kinase 1.
10233887 1999 Activation of hematopoietic progenitor kinase-1 by erythropoietin.
10224067 1999 Hematopoietic progenitor kinase 1 is a component of transforming growth factor beta-induced c-Jun N-terminal kinase signaling cascade.
9891069 1999 Interaction of hematopoietic progenitor kinase 1 with adapter proteins Crk and CrkL leads to synergistic activation of c-Jun N-terminal kinase.
9788432 1998 The germinal center kinase (GCK)-related protein kinases HPK1 and KHS are candidates for highly selective signal transducers of Crk family adapter proteins.
9346925 1997 SH2/SH3 adaptor proteins can link tyrosine kinases to a Ste20-related protein kinase, HPK1.
8824585 1996 Human HPK1, a novel human hematopoietic progenitor kinase that activates the JNK/SAPK kinase cascade.